PREDICTED: Stomoxys calcitrans ubiquitin-like protein 5

LOCUS       XM_013255869             460 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089879), mRNA.
ACCESSION   XM_013255869
VERSION     XM_013255869.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255869.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..460
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..460
                     /gene="LOC106089879"
                     /note="ubiquitin-like protein 5; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106089879"
     CDS             134..355
                     /gene="LOC106089879"
                     /codon_start=1
                     /product="ubiquitin-like protein 5"
                     /protein_id="XP_013111323.1"
                     /db_xref="GeneID:106089879"
                     /translation="MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKYDKIVL
                     KKWYTIFKDSIKLSDYEIHDGMNLELYYQ"
     misc_feature    134..346
                     /gene="LOC106089879"
                     /note="ubiquitin-like (Ubl) domain found in ubiquitin-like
                     protein 5 (UBL5) and similar proteins; Region: Ubl_UBL5;
                     cd01791"
                     /db_xref="CDD:340489"
     misc_feature    order(134..136,176..178,182..190,197..199,209..211,
                     218..223,230..235)
                     /gene="LOC106089879"
                     /note="HIND interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:340489"
     polyA_site      460
                     /gene="LOC106089879"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cactttgtcc agctgttttg cgctgtcagt cgaacattcc tggtaataaa acgttttgct
       61 gaaaccaaac agacatcttg atatcttaaa attgtggtca tttattaaat acaaacataa
      121 ataaaccaaa aaaatgattg aaataacttg taatgacaga ttaggcaaaa aagtacgcgt
      181 gaaatgtaat ccagacgaca ccatcggtga cctaaagaaa cttatagcag cgcaaactgg
      241 tacaaaatac gataaaattg ttttgaaaaa gtggtacaca atctttaagg acagcattaa
      301 actttcggat tatgagatcc acgacggcat gaatttggag ctgtattatc aataaacttt
      361 caaagttttc attattgtaa ctagtaatca ttttttactt ttgattaaaa ttatttattt
      421 tactaataac aaaaaataaa atatttttat aacatactaa