Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans anaphase-promoting complex subunit


LOCUS       XM_013255868             555 bp    mRNA    linear   INV 02-SEP-2023
            15B (LOC106089878), mRNA.
ACCESSION   XM_013255868
VERSION     XM_013255868.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255868.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..555
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..555
                     /gene="LOC106089878"
                     /note="anaphase-promoting complex subunit 15B; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:106089878"
     CDS             148..528
                     /gene="LOC106089878"
                     /codon_start=1
                     /product="anaphase-promoting complex subunit 15B"
                     /protein_id="XP_013111322.1"
                     /db_xref="GeneID:106089878"
                     /translation="MSMLPFFPSLRPPIANRIWFDSAAASNEEAEVLKYEREHHSWLD
                     AMKNAAVDIHPMGKVLTMPGLETDDEDANDDSDDSEDTNEDEDTNDRAIPGLPERSAL
                     GLYSPGEEMNLNDDVPVIVGGGSQ"
     misc_feature    160..>324
                     /gene="LOC106089878"
                     /note="Anaphase-promoting complex subunit 15; Region:
                     ANAPC15; pfam15243"
                     /db_xref="CDD:464583"
     polyA_site      555
                     /gene="LOC106089878"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cattttcatc aacgctgctt catataaaat ttgtttgttt actcaacgaa aggagagtgc
       61 ctgttgtctt aaaattgagg gatcccaaat atatatagta actaaatagc aaaaattctt
      121 ggaaaaatct acagaacact ggttattatg tcaatgctgc cgtttttccc atcgttgcga
      181 ccaccaatag ccaatcgcat ttggttcgat agtgctgcgg ccagcaatga agaagcagag
      241 gttctcaaat acgaaagaga gcaccacagt tggttagatg ctatgaaaaa tgctgccgtt
      301 gatatacatc ccatgggaaa agtgctaact atgcccggcc tggaaaccga cgacgaagat
      361 gctaatgacg atagcgatga ttcagaggac actaacgaag acgaagatac aaatgaccgc
      421 gctatacccg gtttaccgga acgttccgca ttaggtcttt attcgcccgg tgaagaaatg
      481 aatttaaacg atgatgtgcc tgtcatagtt ggtggaggat ctcaataaaa aaattaaaaa
      541 ttttgtttac tctta