Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255868 555 bp mRNA linear INV 02-SEP-2023 15B (LOC106089878), mRNA. ACCESSION XM_013255868 VERSION XM_013255868.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255868.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..555 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..555 /gene="LOC106089878" /note="anaphase-promoting complex subunit 15B; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:106089878" CDS 148..528 /gene="LOC106089878" /codon_start=1 /product="anaphase-promoting complex subunit 15B" /protein_id="XP_013111322.1" /db_xref="GeneID:106089878" /translation="MSMLPFFPSLRPPIANRIWFDSAAASNEEAEVLKYEREHHSWLD AMKNAAVDIHPMGKVLTMPGLETDDEDANDDSDDSEDTNEDEDTNDRAIPGLPERSAL GLYSPGEEMNLNDDVPVIVGGGSQ" misc_feature 160..>324 /gene="LOC106089878" /note="Anaphase-promoting complex subunit 15; Region: ANAPC15; pfam15243" /db_xref="CDD:464583" polyA_site 555 /gene="LOC106089878" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cattttcatc aacgctgctt catataaaat ttgtttgttt actcaacgaa aggagagtgc 61 ctgttgtctt aaaattgagg gatcccaaat atatatagta actaaatagc aaaaattctt 121 ggaaaaatct acagaacact ggttattatg tcaatgctgc cgtttttccc atcgttgcga 181 ccaccaatag ccaatcgcat ttggttcgat agtgctgcgg ccagcaatga agaagcagag 241 gttctcaaat acgaaagaga gcaccacagt tggttagatg ctatgaaaaa tgctgccgtt 301 gatatacatc ccatgggaaa agtgctaact atgcccggcc tggaaaccga cgacgaagat 361 gctaatgacg atagcgatga ttcagaggac actaacgaag acgaagatac aaatgaccgc 421 gctatacccg gtttaccgga acgttccgca ttaggtcttt attcgcccgg tgaagaaatg 481 aatttaaacg atgatgtgcc tgtcatagtt ggtggaggat ctcaataaaa aaattaaaaa 541 ttttgtttac tctta