PREDICTED: Stomoxys calcitrans protein sisterless A-like

LOCUS       XM_013255866             477 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089876), mRNA.
ACCESSION   XM_013255866
VERSION     XM_013255866.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255866.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..477
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..477
                     /gene="LOC106089876"
                     /note="protein sisterless A-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106089876"
     CDS             1..477
                     /gene="LOC106089876"
                     /codon_start=1
                     /product="protein sisterless A-like"
                     /protein_id="XP_013111320.2"
                     /db_xref="GeneID:106089876"
                     /translation="MEIPDYINPRNINEMVSMEMKRIQMNCAQKQQQYVEQMLMENPI
                     PFERRTTAATREINSQLSADQLQILQQRSEACRRSRYNSKIRKAKAKYRHKYMTQKLL
                     QSSKMFNCIQDLIGQAESQLLALGLGMEKLQQLRKTYGMDMTVECTTNLEHQLKME"
ORIGIN      
        1 atggagattc cagactacat caatcctcgg aatatcaacg aaatggtcag catggaaatg
       61 aaacgcattc agatgaattg tgcacagaaa cagcaacaat atgttgaaca aatgctaatg
      121 gaaaatccta ttccatttga acggcgaacc acggctgcaa caagggaaat taacagtcaa
      181 ttgtcagcag atcaattgca aatcctacaa caacgctcgg aggcatgtcg tcgttcgcgt
      241 tataacagca aaattcgaaa agccaaagca aaatatcgcc acaaatacat gactcagaaa
      301 ttattgcaaa gttctaaaat gtttaattgc attcaggatt taattggcca ggctgaaagt
      361 caattattgg ctctgggact tggcatggag aaactgcagc agttacgtaa aacgtatggc
      421 atggatatga ccgtggaatg taccacaaat ttggagcacc agcttaaaat ggaatag