Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255801 982 bp mRNA linear INV 02-SEP-2023 (LOC106089810), transcript variant X3, mRNA. ACCESSION XM_013255801 VERSION XM_013255801.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255801.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..982 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..982 /gene="LOC106089810" /note="uncharacterized LOC106089810; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106089810" CDS 127..510 /gene="LOC106089810" /codon_start=1 /product="uncharacterized protein LOC106089810 isoform X3" /protein_id="XP_013111255.2" /db_xref="GeneID:106089810" /translation="MASGANCGHFMMLIIVVNMNVLCRGHPAGGIVFPNDDVSRYRPK MEVENGLRTKSTQQRGSGIIIFREEMLAGAPLKPNMTPSLKVHPNDNAVNVTKQSTSP SGTIDPDEFEDDDETFDHKHTASKR" polyA_site 982 /gene="LOC106089810" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aattccattt agttgcaatt ttcaagttga ataaggcgcg cgcgaattgc ggtttgaggc 61 tttttcgaac tttgtttttg tgtgagagca acaaaaaaca aaaacaaagt aaataatttc 121 cagacaatgg caagtggagc caattgtggg cattttatga tgctaattat tgtagtaaac 181 atgaatgtac tttgccgcgg tcaccccgca gggggcatag tgtttccgaa tgatgacgtc 241 tccagatatc gaccaaaaat ggaggtcgaa aatggcttaa gaacaaaaag cactcaacaa 301 cgtggtagtg gaattattat ctttcgagaa gaaatgcttg ctggcgctcc attgaagcct 361 aatatgacgc catcgcttaa ggttcatccc aacgacaatg cagtgaacgt aacaaaacaa 421 tcaacgtcgc cttctggcac aattgatcct gatgagtttg aagatgacga tgaaactttt 481 gaccacaaac atactgcatc gaagagataa tttgacaaat gaaaacagca acaatcactc 541 aacacaccat ttgagattgg acgacaccaa caaatcggaa gaaacaatca aagttaatgg 601 tcaccagctt acaaatactc ttaataacca aagtatcagc agaacaccag atgtaacaga 661 cacaacaaat cgtagccaaa atttgttaat atttaagaaa aagccgcctg agagcagctc 721 tgaaacctca acatcaggat ccctgcaaac agtaacacct gccaaattgc agcggacaga 781 aagcagtgct gaaacattaa aatcaacagt gcctcctaac aaatcacaag cgacaaagtt 841 tgcagctcaa gaagcggacg atgatgatag tgaaattttt aattggagat ttaccacaag 901 agcactacca aattgtaaat gcaaaatgtt aaataaatgt atcgaaagta ccaattgctg 961 acaaacattt gaaaaagaaa aa