Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089810


LOCUS       XM_013255801             982 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089810), transcript variant X3, mRNA.
ACCESSION   XM_013255801
VERSION     XM_013255801.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255801.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..982
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..982
                     /gene="LOC106089810"
                     /note="uncharacterized LOC106089810; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106089810"
     CDS             127..510
                     /gene="LOC106089810"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089810 isoform X3"
                     /protein_id="XP_013111255.2"
                     /db_xref="GeneID:106089810"
                     /translation="MASGANCGHFMMLIIVVNMNVLCRGHPAGGIVFPNDDVSRYRPK
                     MEVENGLRTKSTQQRGSGIIIFREEMLAGAPLKPNMTPSLKVHPNDNAVNVTKQSTSP
                     SGTIDPDEFEDDDETFDHKHTASKR"
     polyA_site      982
                     /gene="LOC106089810"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aattccattt agttgcaatt ttcaagttga ataaggcgcg cgcgaattgc ggtttgaggc
       61 tttttcgaac tttgtttttg tgtgagagca acaaaaaaca aaaacaaagt aaataatttc
      121 cagacaatgg caagtggagc caattgtggg cattttatga tgctaattat tgtagtaaac
      181 atgaatgtac tttgccgcgg tcaccccgca gggggcatag tgtttccgaa tgatgacgtc
      241 tccagatatc gaccaaaaat ggaggtcgaa aatggcttaa gaacaaaaag cactcaacaa
      301 cgtggtagtg gaattattat ctttcgagaa gaaatgcttg ctggcgctcc attgaagcct
      361 aatatgacgc catcgcttaa ggttcatccc aacgacaatg cagtgaacgt aacaaaacaa
      421 tcaacgtcgc cttctggcac aattgatcct gatgagtttg aagatgacga tgaaactttt
      481 gaccacaaac atactgcatc gaagagataa tttgacaaat gaaaacagca acaatcactc
      541 aacacaccat ttgagattgg acgacaccaa caaatcggaa gaaacaatca aagttaatgg
      601 tcaccagctt acaaatactc ttaataacca aagtatcagc agaacaccag atgtaacaga
      661 cacaacaaat cgtagccaaa atttgttaat atttaagaaa aagccgcctg agagcagctc
      721 tgaaacctca acatcaggat ccctgcaaac agtaacacct gccaaattgc agcggacaga
      781 aagcagtgct gaaacattaa aatcaacagt gcctcctaac aaatcacaag cgacaaagtt
      841 tgcagctcaa gaagcggacg atgatgatag tgaaattttt aattggagat ttaccacaag
      901 agcactacca aattgtaaat gcaaaatgtt aaataaatgt atcgaaagta ccaattgctg
      961 acaaacattt gaaaaagaaa aa