Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089809


LOCUS       XM_013255800            1336 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089809), transcript variant X1, mRNA.
ACCESSION   XM_013255800
VERSION     XM_013255800.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255800.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1336
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1336
                     /gene="LOC106089809"
                     /note="uncharacterized LOC106089809; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:106089809"
     CDS             270..911
                     /gene="LOC106089809"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089809 isoform X1"
                     /protein_id="XP_013111254.1"
                     /db_xref="GeneID:106089809"
                     /translation="MQPLKCSLGLMLALGLFHMSTAMPGRYLRAADNDAESPLVTVEF
                     ADDENDLNPINEATSPDVLDRNKRKITGATFEAKNAVLGFVFGKIDNFLDTNIRILEQ
                     LDRANIEKNKQWDIPKPVPVNDVQSLITAVVSPKIRAVGNIANDLTTGVLTTITAFSG
                     SSSGGNSNNPNAGLGNIVSKVLGFSGPILQGSSGGAGAGGSTTPAPDSDEAGY"
ORIGIN      
        1 tgaaagcagt aataacgtaa aacttagcta ccaccgctaa caccaagttg ctcctgccaa
       61 aatttaagcg tgtcgtgttt gtgattttgt gtttgtaaaa gaaaacaaaa gccaacaagg
      121 aatttacaaa aattcaactg ccttattgtg tattggccta ttgcaaaccg acagcaaata
      181 taagctaaga gccaactcgt gtttgttttt gaaaggaaat cacttcgtta tttgtagcca
      241 aaaacccaaa ccttctactc caactcgata tgcaaccact aaaatgcagt ttaggcctaa
      301 tgcttgcctt gggcctattt cacatgagca cagctatgcc aggacgttat ttacgggcag
      361 ccgataatga tgccgagagt cccttggtta cggtggaatt tgccgatgat gaaaacgatt
      421 tgaatcccat aaatgaggcc acttcacccg atgttttaga tcgtaacaaa agaaaaatta
      481 ccggtgccac atttgaggct aaaaatgctg ttctaggttt cgtctttggc aaaatcgata
      541 acttcttgga caccaatatt cgcattctcg aacaattgga tcgcgccaat attgagaaga
      601 acaagcaatg ggatattcca aagcctgtac cagttaatga tgtccaatct ttgatcacag
      661 ccgtagtctc acctaagatt cgtgccgttg gcaatattgc caatgatttg accaccggag
      721 ttttgaccac catcacagct ttcagcggca gttcctccgg aggaaattcc aataatccca
      781 atgccggtct gggtaatatt gtctcaaagg tcttgggctt ctctggcccc atattgcagg
      841 gatcttccgg tggtgcaggt gctggaggtt cgactacacc agcgcccgac tcagatgagg
      901 ctggctatta aatagattta aactcagcaa gcattatctt aaaggaacca ctaccagcca
      961 ccccccctct ttcgctagta taggtgccga aaaaacccat tgtggaaatc atcttcctgt
     1021 cactaaaaaa aaaaattatt gtaaattttt tgttgaattt cttagtttta gtttagaatt
     1081 gatttaaaat ccatactttt caccgattct atattttttt attttgatcg aattttctat
     1141 ctgcctcact tcttttccat tagatatgcg ttcataaaat tagtaaaatt tttcactttt
     1201 ccatttctca cccaaaaggg attccttaca aactgaactc cccatatacc ttgatttcct
     1261 tgtgtatatt atttaaaaaa aaaaaatcac ctacacacac acacacatgc tattgtaaat
     1321 attaagcatt gcaatt