Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans mpv17-like protein (LOC106089670),


LOCUS       XM_013255596             723 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013255596
VERSION     XM_013255596.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255596.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..723
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..723
                     /gene="LOC106089670"
                     /note="mpv17-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 6
                     Proteins"
                     /db_xref="GeneID:106089670"
     CDS             37..618
                     /gene="LOC106089670"
                     /codon_start=1
                     /product="mpv17-like protein"
                     /protein_id="XP_013111050.2"
                     /db_xref="GeneID:106089670"
                     /translation="MSLRLRLIGPYVSEGLRAAAIMSAGDILAQTVVEKKQMKDIDVI
                     RTMKYGSLGMLFVGPVLKYWFGLLDRTIRGKQGSVSRTLKKMAVDQTIMAPALNFTIA
                     GLVGLINSEEPRQIMERIKVQYPDIMKTNYMIWPAVQIINFGLVPLRYQVVFVQTIAV
                     FWNCFVSQMLNEKLSKSLDEVAEEQTSTSLQSN"
     polyA_site      723
                     /gene="LOC106089670"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tacatattga aaactacaat ttattctaca taaaagatgt ctctacgatt gcggttaata
       61 ggtccatatg tgtccgaagg actgcgggct gcagcgatca tgagcgctgg tgatattctg
      121 gcacagacag tggtggagaa aaaacaaatg aaagatatcg atgtgattcg caccatgaaa
      181 tatggatcat tgggaatgtt atttgttggg cccgtattaa aatattggtt tggactactg
      241 gatcggacca taagaggaaa gcagggtagt gtctcacgta cattgaaaaa gatggcagtt
      301 gatcagacca taatggctcc agcattaaac tttaccattg ccggattagt gggactcatc
      361 aacagtgaag agccacgaca gattatggaa cgcattaaag tccaatatcc ggatataatg
      421 aaaacaaatt atatgatatg gccagctgtt caaattataa actttggcct ggtgccactc
      481 agataccaag tagtgtttgt acaaacgata gctgtgtttt ggaattgttt cgtttctcaa
      541 atgcttaatg aaaagttaag taaatctctg gatgaagttg ctgaagaaca aacatcaaca
      601 agtctacaaa gtaattgagc tgtgatatat ggatagattg ggagttagtt gcagatttat
      661 attttaaata caaaaacttt ttagttgatt aagtataact atttcttaca ccattgtcga
      721 tta