Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255596 723 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013255596 VERSION XM_013255596.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255596.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..723 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..723 /gene="LOC106089670" /note="mpv17-like protein; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106089670" CDS 37..618 /gene="LOC106089670" /codon_start=1 /product="mpv17-like protein" /protein_id="XP_013111050.2" /db_xref="GeneID:106089670" /translation="MSLRLRLIGPYVSEGLRAAAIMSAGDILAQTVVEKKQMKDIDVI RTMKYGSLGMLFVGPVLKYWFGLLDRTIRGKQGSVSRTLKKMAVDQTIMAPALNFTIA GLVGLINSEEPRQIMERIKVQYPDIMKTNYMIWPAVQIINFGLVPLRYQVVFVQTIAV FWNCFVSQMLNEKLSKSLDEVAEEQTSTSLQSN" polyA_site 723 /gene="LOC106089670" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tacatattga aaactacaat ttattctaca taaaagatgt ctctacgatt gcggttaata 61 ggtccatatg tgtccgaagg actgcgggct gcagcgatca tgagcgctgg tgatattctg 121 gcacagacag tggtggagaa aaaacaaatg aaagatatcg atgtgattcg caccatgaaa 181 tatggatcat tgggaatgtt atttgttggg cccgtattaa aatattggtt tggactactg 241 gatcggacca taagaggaaa gcagggtagt gtctcacgta cattgaaaaa gatggcagtt 301 gatcagacca taatggctcc agcattaaac tttaccattg ccggattagt gggactcatc 361 aacagtgaag agccacgaca gattatggaa cgcattaaag tccaatatcc ggatataatg 421 aaaacaaatt atatgatatg gccagctgtt caaattataa actttggcct ggtgccactc 481 agataccaag tagtgtttgt acaaacgata gctgtgtttt ggaattgttt cgtttctcaa 541 atgcttaatg aaaagttaag taaatctctg gatgaagttg ctgaagaaca aacatcaaca 601 agtctacaaa gtaattgagc tgtgatatat ggatagattg ggagttagtt gcagatttat 661 attttaaata caaaaacttt ttagttgatt aagtataact atttcttaca ccattgtcga 721 tta