Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255586 405 bp mRNA linear INV 02-SEP-2023 (LOC106089661), mRNA. ACCESSION XM_013255586 VERSION XM_013255586.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255586.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..405 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..405 /gene="LOC106089661" /note="uncharacterized LOC106089661; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106089661" CDS 3..287 /gene="LOC106089661" /codon_start=1 /product="uncharacterized protein LOC106089661" /protein_id="XP_013111040.2" /db_xref="GeneID:106089661" /translation="MLSPQAATATSSAEAENGDPVKSSTSENEHEDFFDSTLFRWISV FLYLGGISSLGFVLSLYYLLFFDSSIPEIHLRFPISINGVPLQKLQEITD" ORIGIN 1 taatgttgtc tcctcaggca gccacagcca cgtcttctgc cgaagctgaa aacggtgatc 61 ctgttaaaag ctctacttcg gaaaatgagc atgaggattt tttcgactca acattgtttc 121 gctggatttc ggtattttta tatttgggtg gcataagcag tctgggcttt gttctcagcc 181 tctactatct gttgttcttc gattctagca ttccggaaat tcatctgcgt tttccaatat 241 ccatcaatgg cgtgccatta caaaaactgc aagaaattac cgactgaagg agtgaaatga 301 tggtttggtc taatgaagtg tgaaccaata gcttccctta ttacttagcc ctccattact 361 tttctctcca tatccggtga ccattaactt tcgttgagca cttaa