Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089661


LOCUS       XM_013255586             405 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089661), mRNA.
ACCESSION   XM_013255586
VERSION     XM_013255586.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255586.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..405
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..405
                     /gene="LOC106089661"
                     /note="uncharacterized LOC106089661; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106089661"
     CDS             3..287
                     /gene="LOC106089661"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089661"
                     /protein_id="XP_013111040.2"
                     /db_xref="GeneID:106089661"
                     /translation="MLSPQAATATSSAEAENGDPVKSSTSENEHEDFFDSTLFRWISV
                     FLYLGGISSLGFVLSLYYLLFFDSSIPEIHLRFPISINGVPLQKLQEITD"
ORIGIN      
        1 taatgttgtc tcctcaggca gccacagcca cgtcttctgc cgaagctgaa aacggtgatc
       61 ctgttaaaag ctctacttcg gaaaatgagc atgaggattt tttcgactca acattgtttc
      121 gctggatttc ggtattttta tatttgggtg gcataagcag tctgggcttt gttctcagcc
      181 tctactatct gttgttcttc gattctagca ttccggaaat tcatctgcgt tttccaatat
      241 ccatcaatgg cgtgccatta caaaaactgc aagaaattac cgactgaagg agtgaaatga
      301 tggtttggtc taatgaagtg tgaaccaata gcttccctta ttacttagcc ctccattact
      361 tttctctcca tatccggtga ccattaactt tcgttgagca cttaa