Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089659


LOCUS       XM_013255585             665 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089659), mRNA.
ACCESSION   XM_013255585
VERSION     XM_013255585.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255585.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..665
                     /gene="LOC106089659"
                     /note="uncharacterized LOC106089659; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106089659"
     CDS             193..543
                     /gene="LOC106089659"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089659"
                     /protein_id="XP_013111039.1"
                     /db_xref="GeneID:106089659"
                     /translation="MPTTSESLKKVVNIITPPSASDSKNSDAGAQDSRPSPSASSRNY
                     SPPRRTLHGDDVLFPEPTFSEKFMRYLTIAIYLGGLSSLGFFLSIYYIFFWDSRMPPV
                     YKPTKKPPPVFMKP"
     misc_feature    385..489
                     /gene="LOC106089659"
                     /note="TRP-interacting helix; Region: InaF-motif;
                     pfam15018"
                     /db_xref="CDD:464449"
     polyA_site      665
                     /gene="LOC106089659"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgaatttttg atcaagaagt aacgacaatt ttggtgcctc ttaaaaaaaa aagcaaaaat
       61 actaaaaaga caaaaaaaca aaatagctta gctaaattca aaaaaaaatt aactcaaaac
      121 agtttcaaaa gtttagattt ttttttgaca ttattttgta aattttaaat attttcaaag
      181 aaacaaaaaa agatgcccac aaccagtgaa tcccttaaaa aggttgtcaa catcataaca
      241 ccaccctcgg cctccgactc taaaaactct gatgctggtg cccaggattc tcgaccctcg
      301 cccagtgcct caagtcgaaa ctattcacca ccacgtcgta ctttgcatgg cgacgatgtg
      361 ctttttccag agcctacttt ttctgagaaa tttatgcgct atctaacgat tgccatctat
      421 ttgggtggtc tcagcagttt gggtttcttt ctctccatct actacatctt tttttgggat
      481 tctcgcatgc ccccggttta caagcccacc aaaaaaccac ctccggtctt tatgaagcct
      541 taaggaggta atagctgtgc tgcaaaaatt gaccagagta aagaagagat aacgatatac
      601 ccacccccag attttgattt caattgttta agataatcat gcaaaaagga caaaacaaaa
      661 accat