Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255585 665 bp mRNA linear INV 02-SEP-2023 (LOC106089659), mRNA. ACCESSION XM_013255585 VERSION XM_013255585.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255585.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..665 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..665 /gene="LOC106089659" /note="uncharacterized LOC106089659; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106089659" CDS 193..543 /gene="LOC106089659" /codon_start=1 /product="uncharacterized protein LOC106089659" /protein_id="XP_013111039.1" /db_xref="GeneID:106089659" /translation="MPTTSESLKKVVNIITPPSASDSKNSDAGAQDSRPSPSASSRNY SPPRRTLHGDDVLFPEPTFSEKFMRYLTIAIYLGGLSSLGFFLSIYYIFFWDSRMPPV YKPTKKPPPVFMKP" misc_feature 385..489 /gene="LOC106089659" /note="TRP-interacting helix; Region: InaF-motif; pfam15018" /db_xref="CDD:464449" polyA_site 665 /gene="LOC106089659" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgaatttttg atcaagaagt aacgacaatt ttggtgcctc ttaaaaaaaa aagcaaaaat 61 actaaaaaga caaaaaaaca aaatagctta gctaaattca aaaaaaaatt aactcaaaac 121 agtttcaaaa gtttagattt ttttttgaca ttattttgta aattttaaat attttcaaag 181 aaacaaaaaa agatgcccac aaccagtgaa tcccttaaaa aggttgtcaa catcataaca 241 ccaccctcgg cctccgactc taaaaactct gatgctggtg cccaggattc tcgaccctcg 301 cccagtgcct caagtcgaaa ctattcacca ccacgtcgta ctttgcatgg cgacgatgtg 361 ctttttccag agcctacttt ttctgagaaa tttatgcgct atctaacgat tgccatctat 421 ttgggtggtc tcagcagttt gggtttcttt ctctccatct actacatctt tttttgggat 481 tctcgcatgc ccccggttta caagcccacc aaaaaaccac ctccggtctt tatgaagcct 541 taaggaggta atagctgtgc tgcaaaaatt gaccagagta aagaagagat aacgatatac 601 ccacccccag attttgattt caattgttta agataatcat gcaaaaagga caaaacaaaa 661 accat