Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans heat shock protein beta-1


LOCUS       XM_013255579            1428 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089656), transcript variant X1, mRNA.
ACCESSION   XM_013255579
VERSION     XM_013255579.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255579.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1428
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1428
                     /gene="LOC106089656"
                     /note="heat shock protein beta-1; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 35
                     Proteins"
                     /db_xref="GeneID:106089656"
     CDS             221..793
                     /gene="LOC106089656"
                     /codon_start=1
                     /product="heat shock protein beta-6 isoform X1"
                     /protein_id="XP_013111033.1"
                     /db_xref="GeneID:106089656"
                     /translation="MADANKRNIPIKLGDFSVIDTEFSSIRERFDSEMRKMEEEMAKF
                     RHELMNREANFFESTSTTKKTTTTSQSTNSALSSRPKQNYISDISSPLIQEDGDNKVL
                     KLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSIYREYNREFLLPKGVNPESIR
                     SSLSKDGVLTVDAPLPALAAGETMIPIAHK"
     misc_feature    497..745
                     /gene="LOC106089656"
                     /note="Alpha-crystallin domain (ACD) of metazoan
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain (ACD). sHsps are...; Region:
                     metazoan_ACD; cd06526"
                     /db_xref="CDD:107247"
     misc_feature    order(497..511,533..535,539..541,545..550,656..658,
                     719..724)
                     /gene="LOC106089656"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107247"
     polyA_site      1428
                     /gene="LOC106089656"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gctgtcaaat aaaagtaaaa tgaccgggtt cttgttgagt ttaatcataa tcgtgtgaaa
       61 cgtcgcaaca aacgtactac aaaaatatca attaatctag aaaagaacaa caaaatcgga
      121 ttttaaaaaa ccgagaagag atttgaaagc agcagcgaac aaaaaaaaac ttttgtgaaa
      181 ttctatatac agtgtgtgat ttttaacaac aaatacaaca atggccgatg caaacaagcg
      241 taatattccc atcaaattgg gcgatttcag cgtcatcgat acagaattca gcagtattag
      301 agagcgtttc gattccgaaa tgcgcaaaat ggaagaggaa atggccaaat tccgtcatga
      361 attgatgaat cgtgaggcca atttctttga aagcaccagt acaacaaaaa agacaacaac
      421 aaccagccaa tcaacaaact ctgccctctc ctccagacct aaacaaaact acatttccga
      481 tatcagttcc ccattgattc aggaggatgg tgacaataaa gttttgaaat tgcgctttga
      541 tgtcagccag tatgcccccg aagaaattgt tgtcaagact gttgatcaga aattattggt
      601 acatgctaag catgaagaga aatccgacac aaagagcatc tacagggaat acaatcgtga
      661 gttcttgttg cctaagggtg taaatcctga atcgattcgt tcgtccctca gcaaggatgg
      721 tgtactcact gttgacgctc ctttgccggc tcttgctgct ggtgaaacta tgattcccat
      781 tgcccacaag taaatagtta acagaccacc ccctcatccc ggcagtctga gattgtggcg
      841 ttaaatgatc aaacaccacc accaccacca tcaacagatg aatcaatact aagttattaa
      901 cactgctact aagccaggcc acatctacac aaaaaacccc taaacaaaat aacctatccc
      961 ttcttttagt agaggactat catcgttttt gttttaggca actttaatat cccctcccaa
     1021 acccattgtg ctctttccca cttcatgatt ttttataatg cttttgatgt ttgaaagagt
     1081 ttaagagaac gcgtaaatgt gtattttttt aaataaatta ttttgtttat aactattttt
     1141 tatataacat ttataatttc ttttccaatt tattgattag taatctagat tttattaata
     1201 tttgtttttt tttttttaat tttaatttat atcaacaaat caactcgtat tctccaataa
     1261 ataaattggt taattatttt ttatgtgtat ctttaataat ttatgaatgc tgaaaacaat
     1321 atcaattgta tgttaaaata aaatattctt acagtttttg cgctgcgcaa gcctatacaa
     1381 ttggaagaaa aattaataaa aatttgatac tcaaaccaat accaagga