Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255579 1428 bp mRNA linear INV 02-SEP-2023 (LOC106089656), transcript variant X1, mRNA. ACCESSION XM_013255579 VERSION XM_013255579.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255579.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1428 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1428 /gene="LOC106089656" /note="heat shock protein beta-1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 35 Proteins" /db_xref="GeneID:106089656" CDS 221..793 /gene="LOC106089656" /codon_start=1 /product="heat shock protein beta-6 isoform X1" /protein_id="XP_013111033.1" /db_xref="GeneID:106089656" /translation="MADANKRNIPIKLGDFSVIDTEFSSIRERFDSEMRKMEEEMAKF RHELMNREANFFESTSTTKKTTTTSQSTNSALSSRPKQNYISDISSPLIQEDGDNKVL KLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSIYREYNREFLLPKGVNPESIR SSLSKDGVLTVDAPLPALAAGETMIPIAHK" misc_feature 497..745 /gene="LOC106089656" /note="Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps). sHsps are small stress induced proteins with monomeric masses between 12 -43 kDa, whose common feature is the Alpha-crystallin domain (ACD). sHsps are...; Region: metazoan_ACD; cd06526" /db_xref="CDD:107247" misc_feature order(497..511,533..535,539..541,545..550,656..658, 719..724) /gene="LOC106089656" /note="putative dimer interface [polypeptide binding]; other site" /db_xref="CDD:107247" polyA_site 1428 /gene="LOC106089656" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gctgtcaaat aaaagtaaaa tgaccgggtt cttgttgagt ttaatcataa tcgtgtgaaa 61 cgtcgcaaca aacgtactac aaaaatatca attaatctag aaaagaacaa caaaatcgga 121 ttttaaaaaa ccgagaagag atttgaaagc agcagcgaac aaaaaaaaac ttttgtgaaa 181 ttctatatac agtgtgtgat ttttaacaac aaatacaaca atggccgatg caaacaagcg 241 taatattccc atcaaattgg gcgatttcag cgtcatcgat acagaattca gcagtattag 301 agagcgtttc gattccgaaa tgcgcaaaat ggaagaggaa atggccaaat tccgtcatga 361 attgatgaat cgtgaggcca atttctttga aagcaccagt acaacaaaaa agacaacaac 421 aaccagccaa tcaacaaact ctgccctctc ctccagacct aaacaaaact acatttccga 481 tatcagttcc ccattgattc aggaggatgg tgacaataaa gttttgaaat tgcgctttga 541 tgtcagccag tatgcccccg aagaaattgt tgtcaagact gttgatcaga aattattggt 601 acatgctaag catgaagaga aatccgacac aaagagcatc tacagggaat acaatcgtga 661 gttcttgttg cctaagggtg taaatcctga atcgattcgt tcgtccctca gcaaggatgg 721 tgtactcact gttgacgctc ctttgccggc tcttgctgct ggtgaaacta tgattcccat 781 tgcccacaag taaatagtta acagaccacc ccctcatccc ggcagtctga gattgtggcg 841 ttaaatgatc aaacaccacc accaccacca tcaacagatg aatcaatact aagttattaa 901 cactgctact aagccaggcc acatctacac aaaaaacccc taaacaaaat aacctatccc 961 ttcttttagt agaggactat catcgttttt gttttaggca actttaatat cccctcccaa 1021 acccattgtg ctctttccca cttcatgatt ttttataatg cttttgatgt ttgaaagagt 1081 ttaagagaac gcgtaaatgt gtattttttt aaataaatta ttttgtttat aactattttt 1141 tatataacat ttataatttc ttttccaatt tattgattag taatctagat tttattaata 1201 tttgtttttt tttttttaat tttaatttat atcaacaaat caactcgtat tctccaataa 1261 ataaattggt taattatttt ttatgtgtat ctttaataat ttatgaatgc tgaaaacaat 1321 atcaattgta tgttaaaata aaatattctt acagtttttg cgctgcgcaa gcctatacaa 1381 ttggaagaaa aattaataaa aatttgatac tcaaaccaat accaagga