Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255577 839 bp mRNA linear INV 02-SEP-2023 PSF1 (LOC106089654), mRNA. ACCESSION XM_013255577 VERSION XM_013255577.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255577.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..839 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..839 /gene="LOC106089654" /note="DNA replication complex GINS protein PSF1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106089654" CDS 201..803 /gene="LOC106089654" /codon_start=1 /product="DNA replication complex GINS protein PSF1" /protein_id="XP_013111031.1" /db_xref="GeneID:106089654" /translation="MSKSNKMFADKAFELIKDLERSSQTIPPFDDDGVRQVLEEIKAI FDENCAQAANYSTSGDRTLWPLLNFRHAALQRNKRCLLTYLHQRLQRIKALRWEFGPI IPPDIKTNLCEPEVTFFNKYSKSLASYMRSIGDGQGIDLTGDLRPPKSLYIEVRCVED FGKFELEDGEVIYLKKNSQHYLPRSQVETLVRQGILQHIV" misc_feature 225..605 /gene="LOC106089654" /note="Alpha-helical domain of GINS complex protein Psf1; Region: GINS_A_psf1; cd11710" /db_xref="CDD:212548" misc_feature order(303..305,312..314,453..455,465..467,477..482, 531..533,540..542,546..548,552..584) /gene="LOC106089654" /note="tetramer interface [polypeptide binding]; other site" /db_xref="CDD:212548" misc_feature 651..797 /gene="LOC106089654" /note="beta-strand (B) domain of GINS complex protein Psf1; Region: GINS_B_Psf1; cd21696" /db_xref="CDD:412032" misc_feature order(651..662,666..668,687..689,702..704,708..713, 723..725,729..749,753..755,792..794) /gene="LOC106089654" /note="tetramer interface [polypeptide binding]; other site" /db_xref="CDD:412032" ORIGIN 1 aagcaaatag gctgtttata tttttaaata aatgtatttt gaatacgccc atgttcaaca 61 ccacgtctaa acgcaccact tgcaattctt gccatgtact caaaaacagc tgatataaat 121 cttggcgcca aaaaaaagta aacatcaaca aacacattag ccagaaggca gtaagaagtt 181 gtgcaaaatt caacaatagt atgagcaaat caaataaaat gtttgccgat aaggcatttg 241 aattgataaa agacttggaa aggtcttcgc agacaatacc cccattcgat gatgatggtg 301 tgcggcaagt tttggaagaa atcaaagcaa tatttgatga gaattgtgca caggcagcaa 361 attattcaac ttcaggtgat cgaacactgt ggcctctttt gaattttcgg catgcagctc 421 ttcaacgaaa taaacgatgc cttctcacct acttgcacca acgtttgcag cgcatcaagg 481 ccttacgttg ggagtttggc cccattatcc caccagatat caaaacaaat ctgtgcgaac 541 cagaagtaac attctttaac aaatactcca aatctttagc atcatacatg cgttcaattg 601 gtgatggtca aggtattgac ctaacaggcg atctgaggcc tccaaaatca ttgtacatag 661 aggtgcgatg tgttgaagat tttggcaaat ttgaattaga agatggtgaa gtcatatatc 721 tgaaaaagaa cagtcaacat tatttgccac gttcacaggt tgagacgttg gtgcgccaag 781 gtattcttca gcatattgtt tagttatata tacaataaat gttagttttt tttataaat