Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans DNA replication complex GINS protein


LOCUS       XM_013255577             839 bp    mRNA    linear   INV 02-SEP-2023
            PSF1 (LOC106089654), mRNA.
ACCESSION   XM_013255577
VERSION     XM_013255577.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255577.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..839
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..839
                     /gene="LOC106089654"
                     /note="DNA replication complex GINS protein PSF1; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 6 Proteins"
                     /db_xref="GeneID:106089654"
     CDS             201..803
                     /gene="LOC106089654"
                     /codon_start=1
                     /product="DNA replication complex GINS protein PSF1"
                     /protein_id="XP_013111031.1"
                     /db_xref="GeneID:106089654"
                     /translation="MSKSNKMFADKAFELIKDLERSSQTIPPFDDDGVRQVLEEIKAI
                     FDENCAQAANYSTSGDRTLWPLLNFRHAALQRNKRCLLTYLHQRLQRIKALRWEFGPI
                     IPPDIKTNLCEPEVTFFNKYSKSLASYMRSIGDGQGIDLTGDLRPPKSLYIEVRCVED
                     FGKFELEDGEVIYLKKNSQHYLPRSQVETLVRQGILQHIV"
     misc_feature    225..605
                     /gene="LOC106089654"
                     /note="Alpha-helical domain of GINS complex protein Psf1;
                     Region: GINS_A_psf1; cd11710"
                     /db_xref="CDD:212548"
     misc_feature    order(303..305,312..314,453..455,465..467,477..482,
                     531..533,540..542,546..548,552..584)
                     /gene="LOC106089654"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212548"
     misc_feature    651..797
                     /gene="LOC106089654"
                     /note="beta-strand (B) domain of GINS complex protein
                     Psf1; Region: GINS_B_Psf1; cd21696"
                     /db_xref="CDD:412032"
     misc_feature    order(651..662,666..668,687..689,702..704,708..713,
                     723..725,729..749,753..755,792..794)
                     /gene="LOC106089654"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:412032"
ORIGIN      
        1 aagcaaatag gctgtttata tttttaaata aatgtatttt gaatacgccc atgttcaaca
       61 ccacgtctaa acgcaccact tgcaattctt gccatgtact caaaaacagc tgatataaat
      121 cttggcgcca aaaaaaagta aacatcaaca aacacattag ccagaaggca gtaagaagtt
      181 gtgcaaaatt caacaatagt atgagcaaat caaataaaat gtttgccgat aaggcatttg
      241 aattgataaa agacttggaa aggtcttcgc agacaatacc cccattcgat gatgatggtg
      301 tgcggcaagt tttggaagaa atcaaagcaa tatttgatga gaattgtgca caggcagcaa
      361 attattcaac ttcaggtgat cgaacactgt ggcctctttt gaattttcgg catgcagctc
      421 ttcaacgaaa taaacgatgc cttctcacct acttgcacca acgtttgcag cgcatcaagg
      481 ccttacgttg ggagtttggc cccattatcc caccagatat caaaacaaat ctgtgcgaac
      541 cagaagtaac attctttaac aaatactcca aatctttagc atcatacatg cgttcaattg
      601 gtgatggtca aggtattgac ctaacaggcg atctgaggcc tccaaaatca ttgtacatag
      661 aggtgcgatg tgttgaagat tttggcaaat ttgaattaga agatggtgaa gtcatatatc
      721 tgaaaaagaa cagtcaacat tatttgccac gttcacaggt tgagacgttg gtgcgccaag
      781 gtattcttca gcatattgtt tagttatata tacaataaat gttagttttt tttataaat