Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255573 581 bp mRNA linear INV 02-SEP-2023 (LOC106089650), transcript variant X2, mRNA. ACCESSION XM_013255573 VERSION XM_013255573.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255573.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..581 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..581 /gene="LOC106089650" /note="protein lin-52 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106089650" CDS 111..449 /gene="LOC106089650" /codon_start=1 /product="protein lin-52 homolog" /protein_id="XP_013111027.1" /db_xref="GeneID:106089650" /translation="MIKDEEQDEEGLLSLEKLDRASPDLWPEKIPGITDFIAMSNTPI RTPAPEWSRGLSQEDTTAMLQLSQLSPNALIMEIKKIYDEAYQLGVSEAKEMTRGKYL GIFNNAKKKN" misc_feature 144..425 /gene="LOC106089650" /note="Retinal tissue protein; Region: LIN52; pfam10044" /db_xref="CDD:462950" ORIGIN 1 attcccgtga atgaaaggaa gctaagaacc aaaacaaaaa ttaaaaaaat ttttggtcgg 61 ttgtccaaga aagtagtttt taaagttttt taaggtgatt ttgcgattca atgattaagg 121 acgaggaaca ggatgaagaa ggcttgttat cgctagagaa attggacaga gcttcaccag 181 atttgtggcc agagaaaatt ccaggtataa cagatttcat tgcgatgagt aatacaccca 241 ttagaacacc agctcctgaa tggtcgcggg gtctttctca agaagacacc acagcgatgc 301 tacaactcag ccaactatcg ccaaatgctc tgattatgga aattaagaaa atctatgacg 361 aagcctatca attgggagta agtgaagcta aagagatgac acgcggaaaa tatttaggaa 421 tatttaataa tgccaagaaa aagaattgaa caaaaattct ttcttattaa atataagtag 481 tattccgaat agaattaatg tttatactat aaaaatgaaa aaaaaaaacc attctagaaa 541 tttagatctt aaagaatttt tgcaaattgt taaatatatg g