Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans protein lin-52 homolog


LOCUS       XM_013255573             581 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089650), transcript variant X2, mRNA.
ACCESSION   XM_013255573
VERSION     XM_013255573.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255573.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..581
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..581
                     /gene="LOC106089650"
                     /note="protein lin-52 homolog; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106089650"
     CDS             111..449
                     /gene="LOC106089650"
                     /codon_start=1
                     /product="protein lin-52 homolog"
                     /protein_id="XP_013111027.1"
                     /db_xref="GeneID:106089650"
                     /translation="MIKDEEQDEEGLLSLEKLDRASPDLWPEKIPGITDFIAMSNTPI
                     RTPAPEWSRGLSQEDTTAMLQLSQLSPNALIMEIKKIYDEAYQLGVSEAKEMTRGKYL
                     GIFNNAKKKN"
     misc_feature    144..425
                     /gene="LOC106089650"
                     /note="Retinal tissue protein; Region: LIN52; pfam10044"
                     /db_xref="CDD:462950"
ORIGIN      
        1 attcccgtga atgaaaggaa gctaagaacc aaaacaaaaa ttaaaaaaat ttttggtcgg
       61 ttgtccaaga aagtagtttt taaagttttt taaggtgatt ttgcgattca atgattaagg
      121 acgaggaaca ggatgaagaa ggcttgttat cgctagagaa attggacaga gcttcaccag
      181 atttgtggcc agagaaaatt ccaggtataa cagatttcat tgcgatgagt aatacaccca
      241 ttagaacacc agctcctgaa tggtcgcggg gtctttctca agaagacacc acagcgatgc
      301 tacaactcag ccaactatcg ccaaatgctc tgattatgga aattaagaaa atctatgacg
      361 aagcctatca attgggagta agtgaagcta aagagatgac acgcggaaaa tatttaggaa
      421 tatttaataa tgccaagaaa aagaattgaa caaaaattct ttcttattaa atataagtag
      481 tattccgaat agaattaatg tttatactat aaaaatgaaa aaaaaaaacc attctagaaa
      541 tttagatctt aaagaatttt tgcaaattgt taaatatatg g