Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255572 573 bp mRNA linear INV 02-SEP-2023 (LOC106089650), transcript variant X1, mRNA. ACCESSION XM_013255572 VERSION XM_013255572.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255572.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..573 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..573 /gene="LOC106089650" /note="protein lin-52 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106089650" CDS 103..441 /gene="LOC106089650" /codon_start=1 /product="protein lin-52 homolog" /protein_id="XP_013111026.1" /db_xref="GeneID:106089650" /translation="MIKDEEQDEEGLLSLEKLDRASPDLWPEKIPGITDFIAMSNTPI RTPAPEWSRGLSQEDTTAMLQLSQLSPNALIMEIKKIYDEAYQLGVSEAKEMTRGKYL GIFNNAKKKN" misc_feature 136..417 /gene="LOC106089650" /note="Retinal tissue protein; Region: LIN52; pfam10044" /db_xref="CDD:462950" ORIGIN 1 gccattcccg tgaatgaaag gaagctaaga accaaaacaa aaattaaaaa aatttttggt 61 cggttgtcca agaaagtagt ttttaaagtt ttttaagatt caatgattaa ggacgaggaa 121 caggatgaag aaggcttgtt atcgctagag aaattggaca gagcttcacc agatttgtgg 181 ccagagaaaa ttccaggtat aacagatttc attgcgatga gtaatacacc cattagaaca 241 ccagctcctg aatggtcgcg gggtctttct caagaagaca ccacagcgat gctacaactc 301 agccaactat cgccaaatgc tctgattatg gaaattaaga aaatctatga cgaagcctat 361 caattgggag taagtgaagc taaagagatg acacgcggaa aatatttagg aatatttaat 421 aatgccaaga aaaagaattg aacaaaaatt ctttcttatt aaatataagt agtattccga 481 atagaattaa tgtttatact ataaaaatga aaaaaaaaaa ccattctaga aatttagatc 541 ttaaagaatt tttgcaaatt gttaaatata tgg