Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089647


LOCUS       XM_013255569             955 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089647), mRNA.
ACCESSION   XM_013255569
VERSION     XM_013255569.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255569.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..955
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..955
                     /gene="LOC106089647"
                     /note="uncharacterized LOC106089647; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106089647"
     CDS             55..903
                     /gene="LOC106089647"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089647"
                     /protein_id="XP_013111023.2"
                     /db_xref="GeneID:106089647"
                     /translation="MNLVKLIEAVKKHKNIYKNLSDTGARSCTKDWQIVAKDLQNAMN
                     CDVTAAEAQDQWNGVLLAYYEYLRGNQDFALAKHMDFLQPYLFTMIDDHINEEELTNI
                     VEDEENVNSTHTNKEPKDETEGYDGNETGDLAQTIRKDPLNDILIKHQIVQPMEERVE
                     KPKDSAKNDIVITESSAEDSEKGVLLPSDKASAAQQQQTDVNTEKAKDTIEKPSVYPE
                     KIIAAPRNTSSQNDSSFSNLSSMELIFLGYAKQLQKMPLKLQLKTKRKIADIMEDAEL
                     AMMEEA"
     polyA_site      955
                     /gene="LOC106089647"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attatttatt gtattggcaa ccctcatgca cttttatatc tcaaaacata cgacatgaat
       61 ttggtcaaac ttattgaagc ggtaaaaaaa cataagaata tttacaaaaa tttaagtgac
      121 actggagcac gtagttgtac caaggattgg caaatagttg ccaaagattt acaaaatgca
      181 atgaattgcg acgttacagc agccgaagca caagatcaat ggaatggcgt attattggcc
      241 tattacgaat atttgcgagg taatcaagat tttgctttgg ccaagcatat ggactttttg
      301 caaccatatt tgtttaccat gatagacgat cacattaacg aagaagagct aacaaatatt
      361 gtagaagacg aagaaaatgt caacagcacg catactaaca aagaaccaaa agatgagact
      421 gaggggtacg atggcaatga aacgggtgat ttagcccaaa cgatccgtaa agacccctta
      481 aatgatattc ttataaagca ccagatagta cagccaatgg aagaacgagt tgaaaaacca
      541 aaagacagtg ctaaaaatga catagttatc accgaatctt cagctgaaga ttctgaaaaa
      601 ggtgtacttc ttccttccga caaagcatct gcagcacagc aacaacagac tgatgtaaat
      661 actgaaaaag ctaaagacac aattgaaaag ccatcagtgt atccagagaa aataatcgct
      721 gcaccaagaa atacatcatc tcaaaacgat tcttccttca gcaatttaag ctcgatggaa
      781 ttaatattct taggctatgc caaacaatta cagaaaatgc ctttaaagct tcaattgaag
      841 acaaagcgta aaattgctga tattatggaa gatgcagagc tagcaatgat ggaagaggca
      901 tagtaaacaa attgtattgt gtatgaactt aagaaaaaaa gctaaaatcg ataaa