Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255569 955 bp mRNA linear INV 02-SEP-2023 (LOC106089647), mRNA. ACCESSION XM_013255569 VERSION XM_013255569.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255569.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..955 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..955 /gene="LOC106089647" /note="uncharacterized LOC106089647; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106089647" CDS 55..903 /gene="LOC106089647" /codon_start=1 /product="uncharacterized protein LOC106089647" /protein_id="XP_013111023.2" /db_xref="GeneID:106089647" /translation="MNLVKLIEAVKKHKNIYKNLSDTGARSCTKDWQIVAKDLQNAMN CDVTAAEAQDQWNGVLLAYYEYLRGNQDFALAKHMDFLQPYLFTMIDDHINEEELTNI VEDEENVNSTHTNKEPKDETEGYDGNETGDLAQTIRKDPLNDILIKHQIVQPMEERVE KPKDSAKNDIVITESSAEDSEKGVLLPSDKASAAQQQQTDVNTEKAKDTIEKPSVYPE KIIAAPRNTSSQNDSSFSNLSSMELIFLGYAKQLQKMPLKLQLKTKRKIADIMEDAEL AMMEEA" polyA_site 955 /gene="LOC106089647" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attatttatt gtattggcaa ccctcatgca cttttatatc tcaaaacata cgacatgaat 61 ttggtcaaac ttattgaagc ggtaaaaaaa cataagaata tttacaaaaa tttaagtgac 121 actggagcac gtagttgtac caaggattgg caaatagttg ccaaagattt acaaaatgca 181 atgaattgcg acgttacagc agccgaagca caagatcaat ggaatggcgt attattggcc 241 tattacgaat atttgcgagg taatcaagat tttgctttgg ccaagcatat ggactttttg 301 caaccatatt tgtttaccat gatagacgat cacattaacg aagaagagct aacaaatatt 361 gtagaagacg aagaaaatgt caacagcacg catactaaca aagaaccaaa agatgagact 421 gaggggtacg atggcaatga aacgggtgat ttagcccaaa cgatccgtaa agacccctta 481 aatgatattc ttataaagca ccagatagta cagccaatgg aagaacgagt tgaaaaacca 541 aaagacagtg ctaaaaatga catagttatc accgaatctt cagctgaaga ttctgaaaaa 601 ggtgtacttc ttccttccga caaagcatct gcagcacagc aacaacagac tgatgtaaat 661 actgaaaaag ctaaagacac aattgaaaag ccatcagtgt atccagagaa aataatcgct 721 gcaccaagaa atacatcatc tcaaaacgat tcttccttca gcaatttaag ctcgatggaa 781 ttaatattct taggctatgc caaacaatta cagaaaatgc ctttaaagct tcaattgaag 841 acaaagcgta aaattgctga tattatggaa gatgcagagc tagcaatgat ggaagaggca 901 tagtaaacaa attgtattgt gtatgaactt aagaaaaaaa gctaaaatcg ataaa