Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013255394             769 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089545), mRNA.
ACCESSION   XM_013255394
VERSION     XM_013255394.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255394.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..769
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..769
                     /gene="LOC106089545"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106089545"
     CDS             1..756
                     /gene="LOC106089545"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013110848.2"
                     /db_xref="GeneID:106089545"
                     /translation="MERWCSKVAVVTGASKGIGAAIVHCLLKNGIRVVGLSRNVENME
                     QFRNELPLELQPLLSALKCNVGDAECVNKTFDEIERKYGGIDILVNSAGIMNPNSLLT
                     GDVAAMQEILQTNVLGVVHCTQKAFSSMRQRKFDGHVFILNSILGHNIPIFPKDIPPM
                     LGMYIASKWAIKALTEYYRQEFRHFDTKIKVTSISPGITDTTLIDGYARSYSDGNFLN
                     ANDIAESILYALATPSHVQIHEVIVKPVAEFIV"
ORIGIN      
        1 atggaacgtt ggtgtagtaa agtagctgtt gtcaccgggg ctagcaaagg cattggtgct
       61 gccatagttc attgtcttct aaagaatggt attcgagttg ttggcctctc gagaaatgtt
      121 gaaaatatgg agcaatttcg taatgagtta ccccttgaat tacaacccct gttaagtgcc
      181 ctaaaatgca atgtgggtga tgcagaatgc gtcaataaga cattcgatga aatagaacgt
      241 aagtatggtg gtatcgatat tcttgttaat tctgccggaa ttatgaatcc aaattcacta
      301 ctcactggcg atgtggctgc catgcaagaa attcttcaga caaacgtatt gggcgtggta
      361 cattgtaccc aaaaagcttt ttcatcgatg aggcagcgaa aattcgatgg tcatgttttc
      421 attttgaata gcatcttggg ccacaatata ccgatttttc ccaaggacat tccaccaatg
      481 ttgggcatgt acatagcctc caaatgggcc ataaaggcat taacggaata ctatcgacaa
      541 gaatttcggc attttgatac aaagatcaaa gttacgagca taagtcctgg catcacggat
      601 actacgttaa ttgatggcta tgcgaggtca tattcagatg gtaatttttt gaatgccaat
      661 gatatagcag aaagtattct atatgctttg gctactccat cccatgtgca gattcatgaa
      721 gttatagtta aacctgtggc ggagttcata gtttaaaata aaaataaaa