Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255394 769 bp mRNA linear INV 02-SEP-2023 (LOC106089545), mRNA. ACCESSION XM_013255394 VERSION XM_013255394.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255394.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..769 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..769 /gene="LOC106089545" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106089545" CDS 1..756 /gene="LOC106089545" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013110848.2" /db_xref="GeneID:106089545" /translation="MERWCSKVAVVTGASKGIGAAIVHCLLKNGIRVVGLSRNVENME QFRNELPLELQPLLSALKCNVGDAECVNKTFDEIERKYGGIDILVNSAGIMNPNSLLT GDVAAMQEILQTNVLGVVHCTQKAFSSMRQRKFDGHVFILNSILGHNIPIFPKDIPPM LGMYIASKWAIKALTEYYRQEFRHFDTKIKVTSISPGITDTTLIDGYARSYSDGNFLN ANDIAESILYALATPSHVQIHEVIVKPVAEFIV" ORIGIN 1 atggaacgtt ggtgtagtaa agtagctgtt gtcaccgggg ctagcaaagg cattggtgct 61 gccatagttc attgtcttct aaagaatggt attcgagttg ttggcctctc gagaaatgtt 121 gaaaatatgg agcaatttcg taatgagtta ccccttgaat tacaacccct gttaagtgcc 181 ctaaaatgca atgtgggtga tgcagaatgc gtcaataaga cattcgatga aatagaacgt 241 aagtatggtg gtatcgatat tcttgttaat tctgccggaa ttatgaatcc aaattcacta 301 ctcactggcg atgtggctgc catgcaagaa attcttcaga caaacgtatt gggcgtggta 361 cattgtaccc aaaaagcttt ttcatcgatg aggcagcgaa aattcgatgg tcatgttttc 421 attttgaata gcatcttggg ccacaatata ccgatttttc ccaaggacat tccaccaatg 481 ttgggcatgt acatagcctc caaatgggcc ataaaggcat taacggaata ctatcgacaa 541 gaatttcggc attttgatac aaagatcaaa gttacgagca taagtcctgg catcacggat 601 actacgttaa ttgatggcta tgcgaggtca tattcagatg gtaatttttt gaatgccaat 661 gatatagcag aaagtattct atatgctttg gctactccat cccatgtgca gattcatgaa 721 gttatagtta aacctgtggc ggagttcata gtttaaaata aaaataaaa