PREDICTED: Stomoxys calcitrans farnesol dehydrogenase-like

LOCUS       XM_013255392             753 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089543), mRNA.
ACCESSION   XM_013255392
VERSION     XM_013255392.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255392.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 1% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..753
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..753
                     /gene="LOC106089543"
                     /note="farnesol dehydrogenase-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:106089543"
     CDS             1..753
                     /gene="LOC106089543"
                     /codon_start=1
                     /product="farnesol dehydrogenase-like"
                     /protein_id="XP_013110846.2"
                     /db_xref="GeneID:106089543"
                     /translation="MQRWLNRVAVVTGASSGIGAAVIKDLVKNGVRVVGLARRYERVE
                     DIKKNLAPDVRNNLTAIKCDVCSTKSVNKAFDQIIDELGGVDILVNNAGLYQPGQLST
                     MDIISAQKVLQTNVMGVVNCTQRAFKSMKERNADGHVILVNSLTGHYIPGFNGVEAPN
                     LNMYAPSKFALRAMRDIYRQEFIGLGTKIKITSVSPGLVDTEMVPDFVKANVGPAILK
                     PEDISSSIMYAIATPPHVQVHEMIVRPVGEVL"
ORIGIN      
        1 atgcaacgtt ggcttaatag ggtagctgtg gtcactggag ccagttcggg tataggtgct
       61 gctgtaatca aggatctggt gaagaatgga gtacgggtag ttggcctggc aaggcgttat
      121 gagcgagtcg aggatataaa gaagaacttg gcgccagatg tgcgtaacaa tttgacggcc
      181 ataaaatgtg atgtttgcag tacgaaatcg gttaataaag cctttgatca aatcattgat
      241 gaattgggag gagtggacat cttggtaaat aatgccggac tctatcaacc aggtcagctg
      301 tcaactatgg atataataag tgctcaaaaa gtcttacaaa ccaatgtcat gggtgtggtc
      361 aattgtacgc agagagcatt caagtctatg aaagaacgca atgcggatgg ccatgtaata
      421 ttggtgaaca gtttgaccgg tcattatatt cctggcttca atggtgtaga agctccaaat
      481 ctaaatatgt atgccccatc caagtttgcc ttaagggcaa tgagagatat ttataggcaa
      541 gagtttatag gacttggtac taagataaaa ataactagtg tcagtcctgg tttggtagat
      601 acggaaatgg tgcctgactt tgtaaaggcg aatgtcggtc ctgcaatact caagcctgaa
      661 gacatttcat ccagtataat gtatgccatt gctacaccac cacatgttca agtacatgaa
      721 atgatagtac gacctgtggg cgaggtactt taa