Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255389 810 bp mRNA linear INV 02-SEP-2023 (LOC106089541), mRNA. ACCESSION XM_013255389 VERSION XM_013255389.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255389.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..810 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..810 /gene="LOC106089541" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins" /db_xref="GeneID:106089541" CDS 58..810 /gene="LOC106089541" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013110843.1" /db_xref="GeneID:106089541" /translation="MERWQNKVAVVTGASSGIGAAIVKDLVAAGVQVIGLARRQEKIE EIIAGLPQEKRSLLTALKCDVSNLESVNKAFDEIITKFGGVDILVNNAGCIKTGQMVS MDPQLIQSVLQTNVMGVVYCTQRAFKSLKERNVNGHVVLINSICGHKVIAGPPDSAPV SNIYTPSKYAITAITEIYRQEFYGLGTKTKVTSISPGVVDTEILSDEHRKWIEDRILS PHDISNAVLYTLSTPPHVQIHEMIIKPVGELF" misc_feature 58..792 /gene="LOC106089541" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(94..96,100..105,109..111,166..174,328..336,481..489, 547..549,559..561,643..654) /gene="LOC106089541" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(400..402,487..489,547..549,559..561) /gene="LOC106089541" /note="active site" /db_xref="CDD:187535" ORIGIN 1 ttgcctgaaa taaacaatca ctagtaaaag aaacacctaa gggttctgtt ctacaacatg 61 gaacgttggc aaaataaagt agctgtagta acgggagcca gttcaggtat tggtgctgcc 121 attgttaagg atttggtggc ggcaggagtt caagttatcg gcctggccag gcgtcaagaa 181 aaaattgaag aaataattgc agggctaccg caagaaaaac gttcgctatt gacagccctt 241 aaatgtgatg tctcaaattt ggaatcggtt aacaaggctt tcgatgaaat tattaccaaa 301 tttggtgggg ttgacatttt agtaaataac gccggttgca taaaaacagg acagatggtg 361 tccatggatc cccagcttat tcaaagtgta ttacaaacga atgtcatggg tgtggtctat 421 tgcacccagc gggcctttaa atccttgaag gaacgtaatg tcaacggcca tgttgtcctt 481 attaacagca tatgtggtca taaagtgata gctggcccac cagactcagc accagtgtca 541 aacatatata cgcccagcaa atatgccatc actgccataa cagaaatcta tagacaagaa 601 ttctatggtt tgggtaccaa gaccaaagtt acaagcataa gcccgggtgt agtggatact 661 gaaatattgt cagatgagca ccgcaaatgg atagaagatc gcattttgag tccacacgat 721 atttcaaatg ctgtcttata tacattgtcc acaccgcccc atgtacaaat ccatgaaatg 781 atcattaagc cagtggggga acttttttaa