Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013255389             810 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089541), mRNA.
ACCESSION   XM_013255389
VERSION     XM_013255389.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255389.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..810
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..810
                     /gene="LOC106089541"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 16
                     Proteins"
                     /db_xref="GeneID:106089541"
     CDS             58..810
                     /gene="LOC106089541"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013110843.1"
                     /db_xref="GeneID:106089541"
                     /translation="MERWQNKVAVVTGASSGIGAAIVKDLVAAGVQVIGLARRQEKIE
                     EIIAGLPQEKRSLLTALKCDVSNLESVNKAFDEIITKFGGVDILVNNAGCIKTGQMVS
                     MDPQLIQSVLQTNVMGVVYCTQRAFKSLKERNVNGHVVLINSICGHKVIAGPPDSAPV
                     SNIYTPSKYAITAITEIYRQEFYGLGTKTKVTSISPGVVDTEILSDEHRKWIEDRILS
                     PHDISNAVLYTLSTPPHVQIHEMIIKPVGELF"
     misc_feature    58..792
                     /gene="LOC106089541"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(94..96,100..105,109..111,166..174,328..336,481..489,
                     547..549,559..561,643..654)
                     /gene="LOC106089541"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(400..402,487..489,547..549,559..561)
                     /gene="LOC106089541"
                     /note="active site"
                     /db_xref="CDD:187535"
ORIGIN      
        1 ttgcctgaaa taaacaatca ctagtaaaag aaacacctaa gggttctgtt ctacaacatg
       61 gaacgttggc aaaataaagt agctgtagta acgggagcca gttcaggtat tggtgctgcc
      121 attgttaagg atttggtggc ggcaggagtt caagttatcg gcctggccag gcgtcaagaa
      181 aaaattgaag aaataattgc agggctaccg caagaaaaac gttcgctatt gacagccctt
      241 aaatgtgatg tctcaaattt ggaatcggtt aacaaggctt tcgatgaaat tattaccaaa
      301 tttggtgggg ttgacatttt agtaaataac gccggttgca taaaaacagg acagatggtg
      361 tccatggatc cccagcttat tcaaagtgta ttacaaacga atgtcatggg tgtggtctat
      421 tgcacccagc gggcctttaa atccttgaag gaacgtaatg tcaacggcca tgttgtcctt
      481 attaacagca tatgtggtca taaagtgata gctggcccac cagactcagc accagtgtca
      541 aacatatata cgcccagcaa atatgccatc actgccataa cagaaatcta tagacaagaa
      601 ttctatggtt tgggtaccaa gaccaaagtt acaagcataa gcccgggtgt agtggatact
      661 gaaatattgt cagatgagca ccgcaaatgg atagaagatc gcattttgag tccacacgat
      721 atttcaaatg ctgtcttata tacattgtcc acaccgcccc atgtacaaat ccatgaaatg
      781 atcattaagc cagtggggga acttttttaa