Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013255388            1014 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089539), mRNA.
ACCESSION   XM_013255388
VERSION     XM_013255388.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255388.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1014
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1014
                     /gene="LOC106089539"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 12
                     Proteins"
                     /db_xref="GeneID:106089539"
     CDS             4..756
                     /gene="LOC106089539"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013110842.2"
                     /db_xref="GeneID:106089539"
                     /translation="MERWQNKVAVITGASSGIGAAIAKEFVMAGLKVVGLARRTQLME
                     KHKMDLPSEKRSQFIAMYCDVSNPKSINDAFDLIIAQFGGVDVLVNNAGCGQADQLST
                     MNLDDAQKIVNTNIMGVVYCTQRAFKSMKDRHFDGHVILINSIAGHQFFPGVPLKLPA
                     ANIYSPTKFAITALTELYRQEFSGLGTKIKISSISPGVVDTDILLKDLREAAGDCMLQ
                     PEDVSKAVLFMLATPPHVQIHDMIIKPMGEVV"
ORIGIN      
        1 atcatggaac gttggcaaaa taaggtggct gttataactg gagccagttc gggcattggc
       61 gctgccatag ctaaggaatt tgtaatggcc ggtttgaagg tggtgggtct tgctagacgt
      121 acacaactaa tggagaagca caaaatggat ttgcccagcg aaaagcgttc ccaattcatt
      181 gccatgtatt gcgatgttag caatcccaag agcattaatg atgccttcga tttgatcata
      241 gcccaatttg gaggggtaga tgtgttggtg aacaatgccg gttgtggaca ggctgaccaa
      301 ttgtcaacca tgaatttgga tgacgcccaa aagattgtaa acaccaatat catgggtgtg
      361 gtttactgca cccaaagagc ctttaaatcc atgaaagatc gtcattttga tggacatgtc
      421 attttaataa atagcattgc tggtcatcaa ttctttcccg gggttccgtt gaaattaccc
      481 gctgcaaata tttattcacc cactaagttt gccattactg ccctaacaga gttgtatagg
      541 caggaattta gtgggttggg aacaaaaatt aaaatatcga gtataagtcc tggcgtggtg
      601 gatactgata ttttactcaa ggatctacgt gaggcagcag gcgattgtat gcttcaacct
      661 gaagatgtct caaaagcagt tctctttatg ttggcaacac ctccccatgt gcagatacac
      721 gatatgatca ttaaaccaat gggagaagta gtctaaatat gtataatagg gtgggtttat
      781 ttgcatggat gagaaaaaaa attaaaaatc gtacagcaaa aacggaaact acatacaatt
      841 ctaaaatttt tctccgaaga aaccttgtag ttaaaataaa attctaatcc gcccctctcg
      901 acaccaaatt tttttcctgt tttttcggta ttcgtgatca aggtacaggt cgcatttgtt
      961 gtttgattgt cgtaaaattt tgcacaagcc acatttttgg tccaaggacg aacg