Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255388 1014 bp mRNA linear INV 02-SEP-2023 (LOC106089539), mRNA. ACCESSION XM_013255388 VERSION XM_013255388.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255388.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1014 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1014 /gene="LOC106089539" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins" /db_xref="GeneID:106089539" CDS 4..756 /gene="LOC106089539" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013110842.2" /db_xref="GeneID:106089539" /translation="MERWQNKVAVITGASSGIGAAIAKEFVMAGLKVVGLARRTQLME KHKMDLPSEKRSQFIAMYCDVSNPKSINDAFDLIIAQFGGVDVLVNNAGCGQADQLST MNLDDAQKIVNTNIMGVVYCTQRAFKSMKDRHFDGHVILINSIAGHQFFPGVPLKLPA ANIYSPTKFAITALTELYRQEFSGLGTKIKISSISPGVVDTDILLKDLREAAGDCMLQ PEDVSKAVLFMLATPPHVQIHDMIIKPMGEVV" ORIGIN 1 atcatggaac gttggcaaaa taaggtggct gttataactg gagccagttc gggcattggc 61 gctgccatag ctaaggaatt tgtaatggcc ggtttgaagg tggtgggtct tgctagacgt 121 acacaactaa tggagaagca caaaatggat ttgcccagcg aaaagcgttc ccaattcatt 181 gccatgtatt gcgatgttag caatcccaag agcattaatg atgccttcga tttgatcata 241 gcccaatttg gaggggtaga tgtgttggtg aacaatgccg gttgtggaca ggctgaccaa 301 ttgtcaacca tgaatttgga tgacgcccaa aagattgtaa acaccaatat catgggtgtg 361 gtttactgca cccaaagagc ctttaaatcc atgaaagatc gtcattttga tggacatgtc 421 attttaataa atagcattgc tggtcatcaa ttctttcccg gggttccgtt gaaattaccc 481 gctgcaaata tttattcacc cactaagttt gccattactg ccctaacaga gttgtatagg 541 caggaattta gtgggttggg aacaaaaatt aaaatatcga gtataagtcc tggcgtggtg 601 gatactgata ttttactcaa ggatctacgt gaggcagcag gcgattgtat gcttcaacct 661 gaagatgtct caaaagcagt tctctttatg ttggcaacac ctccccatgt gcagatacac 721 gatatgatca ttaaaccaat gggagaagta gtctaaatat gtataatagg gtgggtttat 781 ttgcatggat gagaaaaaaa attaaaaatc gtacagcaaa aacggaaact acatacaatt 841 ctaaaatttt tctccgaaga aaccttgtag ttaaaataaa attctaatcc gcccctctcg 901 acaccaaatt tttttcctgt tttttcggta ttcgtgatca aggtacaggt cgcatttgtt 961 gtttgattgt cgtaaaattt tgcacaagcc acatttttgg tccaaggacg aacg