Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255387 864 bp mRNA linear INV 02-SEP-2023 (LOC106089537), mRNA. ACCESSION XM_013255387 VERSION XM_013255387.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255387.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..864 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..864 /gene="LOC106089537" /note="farnesol dehydrogenase-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 Proteins" /db_xref="GeneID:106089537" CDS 42..794 /gene="LOC106089537" /codon_start=1 /product="farnesol dehydrogenase-like" /protein_id="XP_013110841.1" /db_xref="GeneID:106089537" /translation="MERWQNRVAVVTGASSGIGAAIAKDLVMAGLKVVALARRVPRMQ LLRDSLPIEKRSQLIIMQCDVTDLNNVDRVFDEIISKLGGIDILVNNAASLKNGLLST MDIKEVQEVLNTNVLSVVHCTQRAFKSMKDRNFNGHIIIVNSIAGHNVLAGLPQSVPS INIYSPTKFAITAITEMYRQEFHGLGTKIKISSISPGFVDTELLFDELRQAVSHCLLQ SSDVSNAVLYMLSTPPHVQIHEMIIKPLGEAV" misc_feature 42..776 /gene="LOC106089537" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(78..80,84..89,93..95,150..158,312..320,465..473, 531..533,543..545,627..638) /gene="LOC106089537" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(384..386,471..473,531..533,543..545) /gene="LOC106089537" /note="active site" /db_xref="CDD:187535" polyA_site 864 /gene="LOC106089537" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aatttggcca actctagtgc agtttaagat tatatcccac catggaacgt tggcaaaaca 61 gagtggctgt agtgacggga gccagttctg gcataggagc agccattgcc aaggatttgg 121 taatggcagg cctcaaagtt gtagccttgg ctagacgggt gcctcgaatg cagctactaa 181 gagactcttt gccaattgaa aaacgctctc aacttattat tatgcaatgt gatgttaccg 241 acttgaataa tgtggataga gtcttcgacg aaattatctc aaaactagga ggcatcgata 301 tattggtcaa caatgctgca agtctgaaaa atggtctatt gtccaccatg gatattaagg 361 aggttcagga agtacttaat accaatgtcc ttagtgtggt ccattgtacg cagagggcat 421 tcaaatcgat gaaagataga aatttcaatg gtcacattat tatagtcaat agtatagctg 481 gtcataatgt attggcaggg ttgcctcaga gtgttcccag cataaatatt tactcaccca 541 ctaaatttgc tattacagct ataacagaaa tgtaccggca ggaattccat ggattgggta 601 caaaaatcaa aatttcgagt ataagccccg gctttgtgga cacagagctt ttatttgacg 661 aactacgtca agcggtttcc cactgcctgc tacagtcaag cgatgtttca aatgccgttt 721 tgtatatgct gtctactcca ccccatgtcc aaatccatga aatgattata aaacccttag 781 gagaagctgt ttgaggaagt ttttagtatg cggttgacag gctacagatt tttcttaaat 841 aaacggttga agttataaat cgga