Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase-like


LOCUS       XM_013255387             864 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089537), mRNA.
ACCESSION   XM_013255387
VERSION     XM_013255387.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255387.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..864
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..864
                     /gene="LOC106089537"
                     /note="farnesol dehydrogenase-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 9
                     Proteins"
                     /db_xref="GeneID:106089537"
     CDS             42..794
                     /gene="LOC106089537"
                     /codon_start=1
                     /product="farnesol dehydrogenase-like"
                     /protein_id="XP_013110841.1"
                     /db_xref="GeneID:106089537"
                     /translation="MERWQNRVAVVTGASSGIGAAIAKDLVMAGLKVVALARRVPRMQ
                     LLRDSLPIEKRSQLIIMQCDVTDLNNVDRVFDEIISKLGGIDILVNNAASLKNGLLST
                     MDIKEVQEVLNTNVLSVVHCTQRAFKSMKDRNFNGHIIIVNSIAGHNVLAGLPQSVPS
                     INIYSPTKFAITAITEMYRQEFHGLGTKIKISSISPGFVDTELLFDELRQAVSHCLLQ
                     SSDVSNAVLYMLSTPPHVQIHEMIIKPLGEAV"
     misc_feature    42..776
                     /gene="LOC106089537"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(78..80,84..89,93..95,150..158,312..320,465..473,
                     531..533,543..545,627..638)
                     /gene="LOC106089537"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(384..386,471..473,531..533,543..545)
                     /gene="LOC106089537"
                     /note="active site"
                     /db_xref="CDD:187535"
     polyA_site      864
                     /gene="LOC106089537"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aatttggcca actctagtgc agtttaagat tatatcccac catggaacgt tggcaaaaca
       61 gagtggctgt agtgacggga gccagttctg gcataggagc agccattgcc aaggatttgg
      121 taatggcagg cctcaaagtt gtagccttgg ctagacgggt gcctcgaatg cagctactaa
      181 gagactcttt gccaattgaa aaacgctctc aacttattat tatgcaatgt gatgttaccg
      241 acttgaataa tgtggataga gtcttcgacg aaattatctc aaaactagga ggcatcgata
      301 tattggtcaa caatgctgca agtctgaaaa atggtctatt gtccaccatg gatattaagg
      361 aggttcagga agtacttaat accaatgtcc ttagtgtggt ccattgtacg cagagggcat
      421 tcaaatcgat gaaagataga aatttcaatg gtcacattat tatagtcaat agtatagctg
      481 gtcataatgt attggcaggg ttgcctcaga gtgttcccag cataaatatt tactcaccca
      541 ctaaatttgc tattacagct ataacagaaa tgtaccggca ggaattccat ggattgggta
      601 caaaaatcaa aatttcgagt ataagccccg gctttgtgga cacagagctt ttatttgacg
      661 aactacgtca agcggtttcc cactgcctgc tacagtcaag cgatgtttca aatgccgttt
      721 tgtatatgct gtctactcca ccccatgtcc aaatccatga aatgattata aaacccttag
      781 gagaagctgt ttgaggaagt ttttagtatg cggttgacag gctacagatt tttcttaaat
      841 aaacggttga agttataaat cgga