Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013255386             861 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089536), mRNA.
ACCESSION   XM_013255386
VERSION     XM_013255386.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255386.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..861
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..861
                     /gene="LOC106089536"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106089536"
     CDS             36..791
                     /gene="LOC106089536"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013110840.2"
                     /db_xref="GeneID:106089536"
                     /translation="MDRWYNKVAVVTGASKGIGAAITQAFLKNGIQVVGLARHIEPME
                     QMKKELPAELQHKFSALKCNVSDLHWVNEAFDEIESKCDGIDILVNSAGLFHPQSLLN
                     GDISFIQEMLLTNVMGVVHCNQRAYKSMRDRNFDGHIFIINSIGGHNIPIAPKEVPPM
                     VGMYVASKWSLKAMAEIYRQEFRHFDTKIKITTISPGATDTPFLDNYLRDYTDGNFLN
                     AEDVAHSVLYALGTPTHVQVHDLIVKPVAEFVL"
ORIGIN      
        1 caactttgat tttttggttt ttttcttttt caacaatgga tcgttggtac aacaaagtcg
       61 ccgttgtgac aggtgccagc aaaggcatag gtgctgccat aacacaggct ttcctgaaga
      121 atggtatcca agttgtaggt ctggctagac acatagaacc tatggagcag atgaagaaag
      181 aattacctgc agaactgcaa cacaagttta gtgctctaaa atgtaatgtc tccgatttgc
      241 attgggtgaa tgaagcattt gacgaaattg agagcaaatg cgatggcatc gatatacttg
      301 ttaactcagc tgggttgttt catccacagt cacttctaaa cggtgacatc agtttcatac
      361 aagaaatgct gctaaccaat gttatgggtg tggtccattg caaccaaaga gcctacaaat
      421 ctatgagaga tcgtaatttc gatggtcata tctttattat aaacagtatt ggaggccata
      481 atatacccat agcacccaaa gaggtcccac ccatggtggg catgtacgtt gcatccaagt
      541 ggtctttaaa agcaatggcg gaaatttata gacaagaatt tcgtcacttt gatacaaaaa
      601 ttaaaatcac taccataagt cctggtgcaa cggacacacc tttccttgat aactatctaa
      661 gggactatac ggatggaaat tttttgaatg ctgaagatgt ggcccatagc gtgctatatg
      721 cccttggcac accaacacat gtgcaggttc atgatttgat tgttaaaccg gtggccgaat
      781 ttgttcttta gtatctcact gtgttattcc ttgtggttat tattgggggg taaaaaaata
      841 aaacaaggca aaatctgggt a