Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255386 861 bp mRNA linear INV 02-SEP-2023 (LOC106089536), mRNA. ACCESSION XM_013255386 VERSION XM_013255386.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255386.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..861 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..861 /gene="LOC106089536" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106089536" CDS 36..791 /gene="LOC106089536" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013110840.2" /db_xref="GeneID:106089536" /translation="MDRWYNKVAVVTGASKGIGAAITQAFLKNGIQVVGLARHIEPME QMKKELPAELQHKFSALKCNVSDLHWVNEAFDEIESKCDGIDILVNSAGLFHPQSLLN GDISFIQEMLLTNVMGVVHCNQRAYKSMRDRNFDGHIFIINSIGGHNIPIAPKEVPPM VGMYVASKWSLKAMAEIYRQEFRHFDTKIKITTISPGATDTPFLDNYLRDYTDGNFLN AEDVAHSVLYALGTPTHVQVHDLIVKPVAEFVL" ORIGIN 1 caactttgat tttttggttt ttttcttttt caacaatgga tcgttggtac aacaaagtcg 61 ccgttgtgac aggtgccagc aaaggcatag gtgctgccat aacacaggct ttcctgaaga 121 atggtatcca agttgtaggt ctggctagac acatagaacc tatggagcag atgaagaaag 181 aattacctgc agaactgcaa cacaagttta gtgctctaaa atgtaatgtc tccgatttgc 241 attgggtgaa tgaagcattt gacgaaattg agagcaaatg cgatggcatc gatatacttg 301 ttaactcagc tgggttgttt catccacagt cacttctaaa cggtgacatc agtttcatac 361 aagaaatgct gctaaccaat gttatgggtg tggtccattg caaccaaaga gcctacaaat 421 ctatgagaga tcgtaatttc gatggtcata tctttattat aaacagtatt ggaggccata 481 atatacccat agcacccaaa gaggtcccac ccatggtggg catgtacgtt gcatccaagt 541 ggtctttaaa agcaatggcg gaaatttata gacaagaatt tcgtcacttt gatacaaaaa 601 ttaaaatcac taccataagt cctggtgcaa cggacacacc tttccttgat aactatctaa 661 gggactatac ggatggaaat tttttgaatg ctgaagatgt ggcccatagc gtgctatatg 721 cccttggcac accaacacat gtgcaggttc atgatttgat tgttaaaccg gtggccgaat 781 ttgttcttta gtatctcact gtgttattcc ttgtggttat tattgggggg taaaaaaata 841 aaacaaggca aaatctgggt a