Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255385 794 bp mRNA linear INV 02-SEP-2023 (LOC106089535), mRNA. ACCESSION XM_013255385 VERSION XM_013255385.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255385.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..794 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..794 /gene="LOC106089535" /note="farnesol dehydrogenase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106089535" CDS 8..763 /gene="LOC106089535" /codon_start=1 /product="farnesol dehydrogenase" /protein_id="XP_013110839.2" /db_xref="GeneID:106089535" /translation="MERWHNKVAVVTGASSGIGAAIVQSLLNSGLCVVGLARRLESME KIKTVLPKELQEKFTPIKCNVGDVHSVNEAFDEIEREYKGVDILVNSAGTINPTSLLT GDVSSIQEILQTNVMGVVHCNQRAYKSMKKRNFDGHVIILNSIVGHNLSIFPKEMLPV LGMYTASKWAVTALTEMYRQEFRHFDTKIKITSISPGIVDTALIDGLVRSCSEGNCLN VNDVAASVLYALGTAPHVQIHELKIKPVAESVV" ORIGIN 1 agtagcaatg gagaggtggc acaataaagt agctgtagtg accggagcca gcagcggcat 61 aggtgctgcc atagttcaaa gtcttctcaa cagtggtctt tgcgttgtag gtctcgcaag 121 acgcctggaa agtatggaaa aaatcaaaac cgtattacct aaggaattac aagagaaatt 181 tacgccaatc aaatgcaatg tgggggatgt acactcagta aatgaggctt tcgatgagat 241 agaacgtgaa tataaaggag tagatatttt ggtgaattct gctggaacca taaatccaac 301 ctctctactc accggcgatg taagttccat acaagaaatt ctccaaacca atgtcatggg 361 tgtggtgcac tgtaaccaaa gagcttacaa atcaatgaaa aagcggaatt tcgatggtca 421 tgtgattatt ttgaatagca ttgtgggcca taatttatcg atatttccca aagagatgct 481 tcctgttctg ggcatgtata cagcttccaa gtgggccgta actgctctaa ctgaaatgta 541 tcggcaggaa tttcgacatt tcgatacgaa aatcaaaatc accagtatta gtccaggaat 601 tgtggataca gcattaattg acggtttggt aaggtcatgc tctgagggta actgtttgaa 661 tgttaacgat gtagctgcaa gtgttctata cgcccttggc actgctccac atgttcaaat 721 acatgaacta aaaattaaac cggtggcaga gagtgtagtg taaaaaagtg tggataaaaa 781 aggttatcac caaa