Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans farnesol dehydrogenase


LOCUS       XM_013255385             794 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089535), mRNA.
ACCESSION   XM_013255385
VERSION     XM_013255385.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255385.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..794
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..794
                     /gene="LOC106089535"
                     /note="farnesol dehydrogenase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106089535"
     CDS             8..763
                     /gene="LOC106089535"
                     /codon_start=1
                     /product="farnesol dehydrogenase"
                     /protein_id="XP_013110839.2"
                     /db_xref="GeneID:106089535"
                     /translation="MERWHNKVAVVTGASSGIGAAIVQSLLNSGLCVVGLARRLESME
                     KIKTVLPKELQEKFTPIKCNVGDVHSVNEAFDEIEREYKGVDILVNSAGTINPTSLLT
                     GDVSSIQEILQTNVMGVVHCNQRAYKSMKKRNFDGHVIILNSIVGHNLSIFPKEMLPV
                     LGMYTASKWAVTALTEMYRQEFRHFDTKIKITSISPGIVDTALIDGLVRSCSEGNCLN
                     VNDVAASVLYALGTAPHVQIHELKIKPVAESVV"
ORIGIN      
        1 agtagcaatg gagaggtggc acaataaagt agctgtagtg accggagcca gcagcggcat
       61 aggtgctgcc atagttcaaa gtcttctcaa cagtggtctt tgcgttgtag gtctcgcaag
      121 acgcctggaa agtatggaaa aaatcaaaac cgtattacct aaggaattac aagagaaatt
      181 tacgccaatc aaatgcaatg tgggggatgt acactcagta aatgaggctt tcgatgagat
      241 agaacgtgaa tataaaggag tagatatttt ggtgaattct gctggaacca taaatccaac
      301 ctctctactc accggcgatg taagttccat acaagaaatt ctccaaacca atgtcatggg
      361 tgtggtgcac tgtaaccaaa gagcttacaa atcaatgaaa aagcggaatt tcgatggtca
      421 tgtgattatt ttgaatagca ttgtgggcca taatttatcg atatttccca aagagatgct
      481 tcctgttctg ggcatgtata cagcttccaa gtgggccgta actgctctaa ctgaaatgta
      541 tcggcaggaa tttcgacatt tcgatacgaa aatcaaaatc accagtatta gtccaggaat
      601 tgtggataca gcattaattg acggtttggt aaggtcatgc tctgagggta actgtttgaa
      661 tgttaacgat gtagctgcaa gtgttctata cgcccttggc actgctccac atgttcaaat
      721 acatgaacta aaaattaaac cggtggcaga gagtgtagtg taaaaaagtg tggataaaaa
      781 aggttatcac caaa