PREDICTED: Stomoxys calcitrans farnesol dehydrogenase-like

LOCUS       XM_013255382             753 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089532), mRNA.
ACCESSION   XM_013255382
VERSION     XM_013255382.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255382.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..753
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..753
                     /gene="LOC106089532"
                     /note="farnesol dehydrogenase-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 11
                     Proteins"
                     /db_xref="GeneID:106089532"
     CDS             1..753
                     /gene="LOC106089532"
                     /codon_start=1
                     /product="farnesol dehydrogenase-like"
                     /protein_id="XP_013110836.1"
                     /db_xref="GeneID:106089532"
                     /translation="MERWQNKVAVVTGASSGIGAAIAKDFVLAGLKVVALARRLQRME
                     EIKQSLPQDKQSQLSIMYCNVTDPANVDKVFDQIIDEFGGIDVLVNNAGCAKSGQLVD
                     MDLKDITNILHTNVLGVVHCTQRAFKSMKERNFAGHVIIVNSIAGHTVLAGLPMSVPN
                     VNIYSPTKFAVRAITEMYRQEFHGLGTKIKISSISPGFTDTEILYGDVRAALGDCMLD
                     AHDVSNAVLYILSTPPHVQIHDLLIKPLGEGI"
     misc_feature    1..735
                     /gene="LOC106089532"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(37..39,43..48,52..54,109..117,271..279,424..432,
                     490..492,502..504,586..597)
                     /gene="LOC106089532"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(343..345,430..432,490..492,502..504)
                     /gene="LOC106089532"
                     /note="active site"
                     /db_xref="CDD:187535"
ORIGIN      
        1 atggaacgtt ggcaaaataa ggtggctgtt gtaacgggtg ctagttcagg aattggggcg
       61 gccattgcca aagattttgt tttggctggc ttaaaggtgg tagctttggc acgccgcttg
      121 caacgcatgg aagaaattaa acagtctttg ccacaggata aacaatctca gttaagcata
      181 atgtattgca atgtcacaga tcctgccaat gtggataagg ttttcgatca aataattgat
      241 gaattcggtg gcattgatgt attggtcaac aatgctggct gtgctaagag tggccaattg
      301 gtggatatgg atttaaagga tattacaaat atattgcaca ccaatgtctt gggagttgtg
      361 cattgtacgc agagagcctt taaatcaatg aaggagcgca atttcgctgg acatgtcatt
      421 attgtcaata gcattgcagg ccatactgtt ttggcgggtt tgcccatgtc tgtgcccaac
      481 gtaaatattt actctcccac caaatttgcc gtaagagcca taactgaaat gtataggcaa
      541 gaatttcatg gtttgggcac caaaatcaag atatctagca ttagccctgg tttcacggat
      601 actgaaattt tgtacggcga tgttcgtgct gctttgggtg attgcatgct ggatgctcat
      661 gatgtctcca atgctgtttt gtatatattg tccacgccac cacacgttca aattcacgat
      721 ctgttgataa aaccccttgg agaaggcatc taa