Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255329 918 bp mRNA linear INV 02-SEP-2023 (LOC106089485), mRNA. ACCESSION XM_013255329 VERSION XM_013255329.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255329.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..918 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..918 /gene="LOC106089485" /note="uncharacterized LOC106089485; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106089485" CDS 97..684 /gene="LOC106089485" /codon_start=1 /product="uncharacterized protein LOC106089485" /protein_id="XP_013110783.2" /db_xref="GeneID:106089485" /translation="MKFILVAILLLLNISQSFHMEMSDGEDETDMYTFGENYDISPEE LSEIPRHRAKRGIWDFFQKMVITKNLIVEQYTDTKDTLNEVFTMFNSQFSDTPNATPR STEVTTPKSSSEDTTDSSEVKSTTERFSISRYDFGRILGRNFRGLRRLTEIEFRDALN ATHYNIADYKAEANKQFANSLAAEKKKQIKALVRG" ORIGIN 1 aaaaactaaa aaatgttaaa acaagaaaaa ttaaataatc agtgaaaaaa atcgtaatat 61 tattgaaagt gtattttaaa gtaccgaatt ctcagtatga agttcatttt agttgctatt 121 ctactgttgc tcaatatctc ccagtcattt cacatggaaa tgagtgatgg tgaggatgaa 181 acagatatgt atacatttgg agaaaattat gatatttcac cggaagagct aagtgaaatt 241 ccaagacatc gggcgaaacg tggcatatgg gacttttttc aaaaaatggt cataaccaaa 301 aatttgattg ttgagcaata taccgatact aaagataccc taaatgaagt tttcaccatg 361 ttcaatagcc aattttcgga tactccgaat gctacaccac gcagcacaga agtcacaacc 421 ccgaaatcca gcagtgaaga taccaccgac agttctgaag tcaaatctac aacggaacga 481 ttttcaatat ctcgatatga ctttggacgc atcctgggtc gtaatttccg aggtcttcga 541 cgtttgactg aaattgaatt tcgcgatgct ctcaatgcaa cacattacaa tatagcggat 601 tacaaagcgg aagcgaataa acagtttgct aatagtttgg cagctgaaaa gaaaaaacaa 661 ataaaagcct tagtcagagg ttaattaaat aaaaaaacaa atgtagttta gtgtagaata 721 gaaatattaa tagcctgttt gtcggtctcg aagtctaact tttgcattaa ttaagagttt 781 gtttgaacga caattcaaag gaaatttcaa gaagctctta cagaagatgc agaagatata 841 taccagaaac catctagatt gacaaaacag ggttcgagta actgcatttc attcgtctgg 901 ggtttctttt tcgacatt