Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089485


LOCUS       XM_013255329             918 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089485), mRNA.
ACCESSION   XM_013255329
VERSION     XM_013255329.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255329.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..918
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..918
                     /gene="LOC106089485"
                     /note="uncharacterized LOC106089485; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106089485"
     CDS             97..684
                     /gene="LOC106089485"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089485"
                     /protein_id="XP_013110783.2"
                     /db_xref="GeneID:106089485"
                     /translation="MKFILVAILLLLNISQSFHMEMSDGEDETDMYTFGENYDISPEE
                     LSEIPRHRAKRGIWDFFQKMVITKNLIVEQYTDTKDTLNEVFTMFNSQFSDTPNATPR
                     STEVTTPKSSSEDTTDSSEVKSTTERFSISRYDFGRILGRNFRGLRRLTEIEFRDALN
                     ATHYNIADYKAEANKQFANSLAAEKKKQIKALVRG"
ORIGIN      
        1 aaaaactaaa aaatgttaaa acaagaaaaa ttaaataatc agtgaaaaaa atcgtaatat
       61 tattgaaagt gtattttaaa gtaccgaatt ctcagtatga agttcatttt agttgctatt
      121 ctactgttgc tcaatatctc ccagtcattt cacatggaaa tgagtgatgg tgaggatgaa
      181 acagatatgt atacatttgg agaaaattat gatatttcac cggaagagct aagtgaaatt
      241 ccaagacatc gggcgaaacg tggcatatgg gacttttttc aaaaaatggt cataaccaaa
      301 aatttgattg ttgagcaata taccgatact aaagataccc taaatgaagt tttcaccatg
      361 ttcaatagcc aattttcgga tactccgaat gctacaccac gcagcacaga agtcacaacc
      421 ccgaaatcca gcagtgaaga taccaccgac agttctgaag tcaaatctac aacggaacga
      481 ttttcaatat ctcgatatga ctttggacgc atcctgggtc gtaatttccg aggtcttcga
      541 cgtttgactg aaattgaatt tcgcgatgct ctcaatgcaa cacattacaa tatagcggat
      601 tacaaagcgg aagcgaataa acagtttgct aatagtttgg cagctgaaaa gaaaaaacaa
      661 ataaaagcct tagtcagagg ttaattaaat aaaaaaacaa atgtagttta gtgtagaata
      721 gaaatattaa tagcctgttt gtcggtctcg aagtctaact tttgcattaa ttaagagttt
      781 gtttgaacga caattcaaag gaaatttcaa gaagctctta cagaagatgc agaagatata
      841 taccagaaac catctagatt gacaaaacag ggttcgagta actgcatttc attcgtctgg
      901 ggtttctttt tcgacatt