Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255328 613 bp mRNA linear INV 02-SEP-2023 (LOC106089484), mRNA. ACCESSION XM_013255328 VERSION XM_013255328.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255328.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..613 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..613 /gene="LOC106089484" /note="uncharacterized LOC106089484; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106089484" CDS 116..454 /gene="LOC106089484" /codon_start=1 /product="uncharacterized protein LOC106089484" /protein_id="XP_013110782.1" /db_xref="GeneID:106089484" /translation="MKSLIVWTFLALILLSATKAEEEKKECGGDPEKDGQVTAWFKNA GCTLKPYADSVASTAKKFGNTVVQTYDDVKHRLTDSDEKKPEDSSTPATVTSTEKVLL APLPGQGTTA" polyA_site 613 /gene="LOC106089484" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccaactgtta gttgctcaca gaccatcgtt acattaacac ttcacatcaa gtcgagctcg 61 gattacgttt tgttcgttaa ccaacaacaa ttgtacacac actcacaact gaaagatgaa 121 atctttaatc gtttggacat ttttggcctt aattctgttg tctgcaacaa aggccgagga 181 ggagaaaaaa gaatgcggtg gggatcccga aaaggatgga caagttactg cttggttcaa 241 aaatgccgga tgcactctga agccctatgc cgattcggtg gcctccacag caaagaaatt 301 cggtaacact gtggtccaga catatgacga tgtcaagcac aggctgaccg acagcgatga 361 gaagaagccc gaagatagtt caacacccgc caccgtcact tcgaccgaga aggtgctatt 421 ggccccccta cctggccagg gcacaacagc ctgacaagtt tgattgcccc aagggtcaag 481 tgcgcgatca tcaaagtcag tgcaggcctg gtgtatagtt tttttacaca ttttgttgtt 541 acttcatatc aatctattgg aagcgaaaag aaaaggaaaa taaaacaaat tttaactaaa 601 gcatataaag caa