Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans anti-sigma-I factor RsgI5-like


LOCUS       XM_013255327             657 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089483), mRNA.
ACCESSION   XM_013255327
VERSION     XM_013255327.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255327.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..657
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..657
                     /gene="LOC106089483"
                     /note="anti-sigma-I factor RsgI5-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:106089483"
     CDS             143..550
                     /gene="LOC106089483"
                     /codon_start=1
                     /product="anti-sigma-I factor RsgI5-like"
                     /protein_id="XP_013110781.2"
                     /db_xref="GeneID:106089483"
                     /translation="MAKLSVKVFLLVLVLTIIGYHCLVSDAALIFRIPNCAIKRYDGK
                     CLPTIVKKASARKAIPYPFRLKKVATMPSPRATPSLPPTPTPTPTPTPTPTPTPKATP
                     SPMVKELKQKYDGFWEAFKGKLKASGVCFVNLG"
     polyA_site      657
                     /gene="LOC106089483"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgatgagtgt gcaaatgttc acaaagttaa ggttcccttt aaataattca tgaaaaggat
       61 gatcatttca aaaatcagtt gcctggtgta actttcagca caacaatcaa acggagctaa
      121 cgtttttttt tctaactatt caatggcgaa gttgtctgta aaagtattcc tattggtgct
      181 agtgctgact ataatcggat atcactgcct tgtatccgat gctgcattga tctttaggat
      241 accaaactgt gcaatcaaaa gatacgatgg aaagtgtctt ccaacgattg taaaaaaagc
      301 tagtgcgaga aaagctattc cttacccatt tagattgaaa aaagttgcca ctatgccttc
      361 accaagagcc actccttccc taccaccaac gccaacgcca acgccaacgc caacgccaac
      421 gccaacgcca acgccaaaag ctactccttc accaatggta aaagaattaa aacaaaaata
      481 tgatggattt tgggaagctt ttaaaggtaa attgaaagca tctggtgtat gttttgttaa
      541 cttgggatga aacatctgta atcaatttat gatttctgct gcatcactat ccttgcagta
      601 aaatgtaatt aaaaaaacca aataaaataa aaattcatta aaacattttt ataataa