Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans thioredoxin, mitochondrial


LOCUS       XM_013255293            1021 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089443), transcript variant X3, mRNA.
ACCESSION   XM_013255293
VERSION     XM_013255293.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255293.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1021
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1021
                     /gene="LOC106089443"
                     /note="thioredoxin, mitochondrial; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106089443"
     CDS             273..773
                     /gene="LOC106089443"
                     /codon_start=1
                     /product="thioredoxin, mitochondrial"
                     /protein_id="XP_013110747.1"
                     /db_xref="GeneID:106089443"
                     /translation="MLKIAAEGLMPSLVACIQASSSAQNACQRLAPLAVSATQKFLSQ
                     SQATNKKYTVKDHYEFDQKVINSDTPVIVNFHAEWCDPCKILTPKMIELLQDSNEIDL
                     AIIDVESNTELVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIESLIDKLKSKNRSA
                     TETEAK"
     misc_feature    447..731
                     /gene="LOC106089443"
                     /note="Chaperedoxin CnoX, contains thioredoxin-like and
                     TPR-like domains, YbbN/TrxSC family [Posttranslational
                     modification, protein turnover, chaperones]; Region: CnoX;
                     COG3118"
                     /db_xref="CDD:442352"
     polyA_site      1021
                     /gene="LOC106089443"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ataattaatt taggcgtaaa gtaataataa aacaaataca tttcaataat ttagaaaaaa
       61 gatataaaca tagaaatata tgaatccctc taaaattagc tattgttaaa ttattacctc
      121 attactacgg cacggcatac ggaagaaaca aataaaaggc caacaacaat acagtttagt
      181 ttttgttttt gtaatcattg ctattcatcc agtcattgaa cgcacaaggg gcaatagcta
      241 agtttactgg tgccgcttat agtgaaagaa tcatgttgaa aatagccgct gaaggtttaa
      301 tgccgagttt ggtggcctgt atccaagcta gctcttcggc ccaaaatgcc tgccaacgtc
      361 tggctccctt agcagtttcg gcaacacaaa aatttctatc ccaaagtcaa gcaaccaata
      421 aaaagtacac cgtcaaagat cattatgaat ttgatcagaa ggtcatcaac agcgataccc
      481 ctgtcattgt caatttccat gcagaatggt gtgatccttg caaaatttta acacctaaaa
      541 tgatcgagct actgcaggat tcaaacgaaa tcgatttagc catcattgat gtggaatcaa
      601 ataccgaact ggtggaaaca tttgaagtga aagcggtacc cgcagtcttg gcctttcgca
      661 atggtgttgt tgtagataaa ttcataggct tagtagatgc taatagcata gaatccctaa
      721 ttgacaaatt gaagagtaaa aatcgctcag ctacagaaac tgaggcaaag taatctcatc
      781 ttaaggatgc tagtagtcga cgtcttctta acgtgtgtga tgttagtaat gttctataga
      841 atctaatagt tatacatttt ccataaaata tttgttttca aatttgagat ttgccttaaa
      901 acgatttaac caatcatcat aaactaatca accttaaaat cctttttttt ttaattttgt
      961 tttgttttgt cataaaattt aacataagtt tgtaaagttt aataaaaata tactaaatat
     1021 a