PREDICTED: Stomoxys calcitrans thioredoxin, mitochondrial

LOCUS       XM_013255292             865 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089443), transcript variant X2, mRNA.
ACCESSION   XM_013255292
VERSION     XM_013255292.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255292.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..865
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..865
                     /gene="LOC106089443"
                     /note="thioredoxin, mitochondrial; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 8
                     Proteins"
                     /db_xref="GeneID:106089443"
     CDS             117..617
                     /gene="LOC106089443"
                     /codon_start=1
                     /product="thioredoxin, mitochondrial"
                     /protein_id="XP_013110746.1"
                     /db_xref="GeneID:106089443"
                     /translation="MLKIAAEGLMPSLVACIQASSSAQNACQRLAPLAVSATQKFLSQ
                     SQATNKKYTVKDHYEFDQKVINSDTPVIVNFHAEWCDPCKILTPKMIELLQDSNEIDL
                     AIIDVESNTELVETFEVKAVPAVLAFRNGVVVDKFIGLVDANSIESLIDKLKSKNRSA
                     TETEAK"
     misc_feature    291..575
                     /gene="LOC106089443"
                     /note="Chaperedoxin CnoX, contains thioredoxin-like and
                     TPR-like domains, YbbN/TrxSC family [Posttranslational
                     modification, protein turnover, chaperones]; Region: CnoX;
                     COG3118"
                     /db_xref="CDD:442352"
     polyA_site      865
                     /gene="LOC106089443"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaatgtcaaa gtttttttgt ttttttttac acattttcct tgttttgatc tgcgacgaaa
       61 attaaatcgg gtttatttaa taaaacttta ctggtgccgc ttatagtgaa agaatcatgt
      121 tgaaaatagc cgctgaaggt ttaatgccga gtttggtggc ctgtatccaa gctagctctt
      181 cggcccaaaa tgcctgccaa cgtctggctc ccttagcagt ttcggcaaca caaaaatttc
      241 tatcccaaag tcaagcaacc aataaaaagt acaccgtcaa agatcattat gaatttgatc
      301 agaaggtcat caacagcgat acccctgtca ttgtcaattt ccatgcagaa tggtgtgatc
      361 cttgcaaaat tttaacacct aaaatgatcg agctactgca ggattcaaac gaaatcgatt
      421 tagccatcat tgatgtggaa tcaaataccg aactggtgga aacatttgaa gtgaaagcgg
      481 tacccgcagt cttggccttt cgcaatggtg ttgttgtaga taaattcata ggcttagtag
      541 atgctaatag catagaatcc ctaattgaca aattgaagag taaaaatcgc tcagctacag
      601 aaactgaggc aaagtaatct catcttaagg atgctagtag tcgacgtctt cttaacgtgt
      661 gtgatgttag taatgttcta tagaatctaa tagttataca ttttccataa aatatttgtt
      721 ttcaaatttg agatttgcct taaaacgatt taaccaatca tcataaacta atcaacctta
      781 aaatcctttt ttttttaatt ttgttttgtt ttgtcataaa atttaacata agtttgtaaa
      841 gtttaataaa aatatactaa atata