Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089229


LOCUS       XM_013255036             915 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089229), mRNA.
ACCESSION   XM_013255036
VERSION     XM_013255036.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013255036.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..915
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..915
                     /gene="LOC106089229"
                     /note="uncharacterized LOC106089229; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106089229"
     CDS             83..802
                     /gene="LOC106089229"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089229"
                     /protein_id="XP_013110490.2"
                     /db_xref="GeneID:106089229"
                     /translation="MENLNAFILPRVLQMVNNTPDLCQPLDNVCVTIKRCLAAETNGP
                     IRFTKVDKAVKEALKVGENLGIVMLKEDMVKLPFKINSGVPMPRIREAVEVSNSNLEI
                     EDDSLEDENAEDEEVEYNPPASTSSAMPSRQMRKQSKKTYYKMKADPEGEDESAEDES
                     AEDEELDNGLPASTSFAISSGQRSRKSKKQNSRMNDDPEDCYGRGTMRQRRAGRPKRG
                     KSQNRSRSRSSRRRGSRRRRS"
     polyA_site      915
                     /gene="LOC106089229"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttgtgtagc tctattagga aacgtcgtgt tatttaaata cataaacatt tttgtatttt
       61 attttaattg aaattggaaa atatggaaaa tttaaatgct ttcatattac ctcgcgtttt
      121 acaaatggtc aacaatacac cagatttatg tcaaccactc gataatgtat gtgtgaccat
      181 aaaacgttgt ttggccgcgg aaactaatgg accaattcgc tttacaaagg tcgataaggc
      241 tgtcaaggag gcactaaaag tgggtgaaaa tctgggaatt gtcatgctga aagaagatat
      301 ggtgaaatta ccatttaaga taaattctgg cgttcccatg ccgcgcattc gagaagcagt
      361 ggaggtttct aattcgaatc tagaaataga ggacgatagt ttagaagacg aaaatgcgga
      421 agacgaagag gtagaatata acccacccgc atcaaccagc tctgccatgc catctagaca
      481 aatgagaaag caatctaaaa agacctatta taaaatgaag gccgatccag agggagagga
      541 tgaaagtgca gaagacgaaa gtgcggaaga cgaagagttg gacaatggtc tacctgcgtc
      601 aaccagcttc gccatctcat ctggacaaag aagcaggaaa tctaaaaagc aaaattctag
      661 aatgaatgat gatccagagg attgttatgg cagaggcacc atgcgccagc gtcgtgctgg
      721 aaggccaaaa cgtggtaaaa gccaaaatcg cagtcgtagt cgcagtagca gacgacgtgg
      781 atcgcgaaga aggcgttctt aaattttgtt gatgttcaaa attctatgaa atgtaaaaaa
      841 aattatgtga ctatttaaaa atttaaaagg ggagaatata ttttccccaa gaaaaaaaaa
      901 gattttctac ttaaa