Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013255036 915 bp mRNA linear INV 02-SEP-2023 (LOC106089229), mRNA. ACCESSION XM_013255036 VERSION XM_013255036.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013255036.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..915 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..915 /gene="LOC106089229" /note="uncharacterized LOC106089229; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106089229" CDS 83..802 /gene="LOC106089229" /codon_start=1 /product="uncharacterized protein LOC106089229" /protein_id="XP_013110490.2" /db_xref="GeneID:106089229" /translation="MENLNAFILPRVLQMVNNTPDLCQPLDNVCVTIKRCLAAETNGP IRFTKVDKAVKEALKVGENLGIVMLKEDMVKLPFKINSGVPMPRIREAVEVSNSNLEI EDDSLEDENAEDEEVEYNPPASTSSAMPSRQMRKQSKKTYYKMKADPEGEDESAEDES AEDEELDNGLPASTSFAISSGQRSRKSKKQNSRMNDDPEDCYGRGTMRQRRAGRPKRG KSQNRSRSRSSRRRGSRRRRS" polyA_site 915 /gene="LOC106089229" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttgtgtagc tctattagga aacgtcgtgt tatttaaata cataaacatt tttgtatttt 61 attttaattg aaattggaaa atatggaaaa tttaaatgct ttcatattac ctcgcgtttt 121 acaaatggtc aacaatacac cagatttatg tcaaccactc gataatgtat gtgtgaccat 181 aaaacgttgt ttggccgcgg aaactaatgg accaattcgc tttacaaagg tcgataaggc 241 tgtcaaggag gcactaaaag tgggtgaaaa tctgggaatt gtcatgctga aagaagatat 301 ggtgaaatta ccatttaaga taaattctgg cgttcccatg ccgcgcattc gagaagcagt 361 ggaggtttct aattcgaatc tagaaataga ggacgatagt ttagaagacg aaaatgcgga 421 agacgaagag gtagaatata acccacccgc atcaaccagc tctgccatgc catctagaca 481 aatgagaaag caatctaaaa agacctatta taaaatgaag gccgatccag agggagagga 541 tgaaagtgca gaagacgaaa gtgcggaaga cgaagagttg gacaatggtc tacctgcgtc 601 aaccagcttc gccatctcat ctggacaaag aagcaggaaa tctaaaaagc aaaattctag 661 aatgaatgat gatccagagg attgttatgg cagaggcacc atgcgccagc gtcgtgctgg 721 aaggccaaaa cgtggtaaaa gccaaaatcg cagtcgtagt cgcagtagca gacgacgtgg 781 atcgcgaaga aggcgttctt aaattttgtt gatgttcaaa attctatgaa atgtaaaaaa 841 aattatgtga ctatttaaaa atttaaaagg ggagaatata ttttccccaa gaaaaaaaaa 901 gattttctac ttaaa