Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans tRNA


LOCUS       XM_013254825             841 bp    mRNA    linear   INV 02-SEP-2023
            (guanine-N(7)-)-methyltransferase (LOC106089067), mRNA.
ACCESSION   XM_013254825
VERSION     XM_013254825.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254825.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..841
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..841
                     /gene="LOC106089067"
                     /note="tRNA (guanine-N(7)-)-methyltransferase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 9 Proteins"
                     /db_xref="GeneID:106089067"
     CDS             56..793
                     /gene="LOC106089067"
                     /codon_start=1
                     /product="tRNA (guanine-N(7)-)-methyltransferase"
                     /protein_id="XP_013110279.2"
                     /db_xref="GeneID:106089067"
                     /translation="MAAMAPSKEDETTALSLPQKRYYRQRAHSNPIADHCFDYPARPA
                     DVDWSTLYPNYDSCSPTKLVEFADIGCGYGGFLVALGEMFPDRISIGMEIRVKVSDYV
                     MDRIKALRSQNPGKYNNIACIRTNAMKYLPNYFVKHQLEKMFFLYPDPHFKKAKHKWR
                     IINQALLSEYAYVLRKGGLVYTMTDVEDLHKWIVKHMEDHPLFERISSEEEANDPITP
                     KLYQSSEEGAKVVRNKGSHFLAIFRRL"
     polyA_site      841
                     /gene="LOC106089067"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gtcattcaat aaaaagagca caacaacacc ttttgaaagt ttacgaacgt ggtcaatggc
       61 agcaatggct ccaagcaaag aagatgaaac tactgcccta tctctcccac aaaagagata
      121 ctaccgccaa agggcacatt caaatcccat tgcagatcat tgttttgatt atccagctcg
      181 tccggccgat gtcgattgga gcactttgta tcccaattat gattcctgta gtccaacgaa
      241 gcttgtagaa tttgctgata taggctgcgg ctatggtggc ttcttagtgg cattgggtga
      301 aatgttccct gatcgcattt ccattggcat ggaaatacgc gtgaaagtat ccgactatgt
      361 catggataga ataaaggcat tacgttccca aaatcctggt aaatacaaca atatcgcttg
      421 tattcgtaca aatgccatga agtacctgcc aaattatttt gttaaacatc agctagagaa
      481 gatgttcttc ctttatcctg atccacattt taaaaaggcc aaacataagt ggcgtattat
      541 taaccaggct ttgttgtcag aatatgccta tgttcttaga aaggggggtt tagtttatac
      601 catgaccgat gtggaagatt tgcacaaatg gattgttaaa cacatggaag atcatccgct
      661 gtttgaaaga atttcctcag aagaagaggc caatgatccc attacaccaa aattgtatca
      721 aagcagtgaa gaaggtgcaa aagttgtaag gaataagggt tcacatttct tagctatatt
      781 tcgaagactt taaaattttg tgcattaaag acttcagttt agtatgtaat ctcaaatttt
      841 a