Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans UPF0184 protein CG14818


LOCUS       XM_013254824             517 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089066), mRNA.
ACCESSION   XM_013254824
VERSION     XM_013254824.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254824.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..517
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..517
                     /gene="LOC106089066"
                     /note="UPF0184 protein CG14818; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106089066"
     CDS             56..322
                     /gene="LOC106089066"
                     /codon_start=1
                     /product="UPF0184 protein CG14818"
                     /protein_id="XP_013110278.1"
                     /db_xref="GeneID:106089066"
                     /translation="MNMSPRNNDDPSEKPQKNVGEDDIQEMEAVNNSLDELSSALDFF
                     EQRTDDIIEQLKELLHSNREIRQELAMENAATGVDNLNLEKKDT"
     misc_feature    62..283
                     /gene="LOC106089066"
                     /note="Uncharacterized protein family (UPF0184); Region:
                     UPF0184; pfam03670"
                     /db_xref="CDD:112485"
     polyA_site      517
                     /gene="LOC106089066"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tgtaggttaa tgccaaaaat tatcagtcag gtgactggaa aataaataaa taaaaatgaa
       61 tatgtcgccc cgaaataatg atgatccttc cgagaaacca caaaaaaatg tcggagaaga
      121 cgatatccaa gaaatggagg ctgtcaacaa cagcctagat gaattgagtt ccgcattgga
      181 cttctttgaa cagcgtacgg atgacattat tgaacagcta aaggaattgt tgcattccaa
      241 tcgagaaata agacaagaac ttgccatgga aaatgcagcc acgggcgtcg ataacttaaa
      301 cttggaaaag aaagatacct gatttatttg ccatatcaaa tcatcatatg gttggaaagg
      361 ggcaaacaaa gaaatatgac aagggcggca aaagaagtat taaacaccgg atgtttagtg
      421 attatatcgt ttatttatct aatcagtaaa ataaagtaac ttagttggat ctgtcattgt
      481 tttgtacacg ggcatacaaa ctaacttaac aaagtaa