Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254824 517 bp mRNA linear INV 02-SEP-2023 (LOC106089066), mRNA. ACCESSION XM_013254824 VERSION XM_013254824.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254824.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..517 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..517 /gene="LOC106089066" /note="UPF0184 protein CG14818; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106089066" CDS 56..322 /gene="LOC106089066" /codon_start=1 /product="UPF0184 protein CG14818" /protein_id="XP_013110278.1" /db_xref="GeneID:106089066" /translation="MNMSPRNNDDPSEKPQKNVGEDDIQEMEAVNNSLDELSSALDFF EQRTDDIIEQLKELLHSNREIRQELAMENAATGVDNLNLEKKDT" misc_feature 62..283 /gene="LOC106089066" /note="Uncharacterized protein family (UPF0184); Region: UPF0184; pfam03670" /db_xref="CDD:112485" polyA_site 517 /gene="LOC106089066" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgtaggttaa tgccaaaaat tatcagtcag gtgactggaa aataaataaa taaaaatgaa 61 tatgtcgccc cgaaataatg atgatccttc cgagaaacca caaaaaaatg tcggagaaga 121 cgatatccaa gaaatggagg ctgtcaacaa cagcctagat gaattgagtt ccgcattgga 181 cttctttgaa cagcgtacgg atgacattat tgaacagcta aaggaattgt tgcattccaa 241 tcgagaaata agacaagaac ttgccatgga aaatgcagcc acgggcgtcg ataacttaaa 301 cttggaaaag aaagatacct gatttatttg ccatatcaaa tcatcatatg gttggaaagg 361 ggcaaacaaa gaaatatgac aagggcggca aaagaagtat taaacaccgg atgtttagtg 421 attatatcgt ttatttatct aatcagtaaa ataaagtaac ttagttggat ctgtcattgt 481 tttgtacacg ggcatacaaa ctaacttaac aaagtaa