Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106089019


LOCUS       XM_013254762             888 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106089019), mRNA.
ACCESSION   XM_013254762
VERSION     XM_013254762.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254762.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..888
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..888
                     /gene="LOC106089019"
                     /note="uncharacterized LOC106089019; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106089019"
     CDS             1..888
                     /gene="LOC106089019"
                     /codon_start=1
                     /product="uncharacterized protein LOC106089019"
                     /protein_id="XP_013110216.2"
                     /db_xref="GeneID:106089019"
                     /translation="MKKVSRDNGGKYYLPHQAVVRENHLTTKVRVVFDASAKTTNGKS
                     LNDVLEVGPKLQQDIFQILLKWRLWIFVLVADVEKMYRQVLGAEDDQPYQNVLWRENL
                     QMPIKEFVLTTVTYGTACAPFLAKRALIEIGKECSKRNPKIQAIIQDDFYMDDLMTGA
                     DFVLECVKIYQDISQQLDKFGFKLRKWMSNELRILEAIPDVGDNLVVRIEEGEMMKTL
                     GVQWDPHTDNFAFYFQISEDKTLTKRKALSTLAKIFDPLGWLTPVTMLAKLFIQRLWL
                     MDLQWDVELNAEMKQVKAC"
ORIGIN      
        1 atgaaaaagg tctcaagaga taacggcggt aaatactatt tgccacatca agcagtagtg
       61 agagaaaatc atcttactac aaaagttcgg gtagtgtttg atgcttcggc caagacaacg
      121 aatggaaaaa gtttaaacga tgtcctggaa gttggtccta aactacaaca agatattttc
      181 caaattttat taaaatggcg gttatggata tttgtcttgg tggcggatgt ggagaagatg
      241 tacagacaag tcttaggagc ggaggacgac cagccgtacc aaaacgtatt gtggcgcgaa
      301 aatctacaga tgccgattaa agagtttgtt ctaacaacag tcacctacgg gacagcatgt
      361 gctccatttc tggcgaaacg agctctgatt gaaatcggga aagagtgcag caagcggaat
      421 ccaaagattc aagccatcat tcaggatgac ttttacatgg atgatttgat gactggagct
      481 gattttgtgc tggaatgcgt caaaatttat caggacatca gccagcaatt ggataagttt
      541 ggattcaagc tgcgcaaatg gatgtccaac gagctgagaa tactagaagc aataccagat
      601 gtgggcgaca atctagtcgt taggattgag gaaggcgaaa tgatgaagac gttgggtgtt
      661 caatgggatc cccatacgga taattttgct ttttattttc agatcagtga agacaaaacc
      721 ctaacgaagc gaaaggcgct atctacactg gccaaaatat ttgatccttt gggttggctg
      781 acgcctgtaa caatgctagc caagctattc atccagaggc tatggttgat ggatttgcaa
      841 tgggacgtcg agttaaacgc tgagatgaaa caagtaaaag cgtgctaa