Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254762 888 bp mRNA linear INV 02-SEP-2023 (LOC106089019), mRNA. ACCESSION XM_013254762 VERSION XM_013254762.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254762.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..888 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..888 /gene="LOC106089019" /note="uncharacterized LOC106089019; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106089019" CDS 1..888 /gene="LOC106089019" /codon_start=1 /product="uncharacterized protein LOC106089019" /protein_id="XP_013110216.2" /db_xref="GeneID:106089019" /translation="MKKVSRDNGGKYYLPHQAVVRENHLTTKVRVVFDASAKTTNGKS LNDVLEVGPKLQQDIFQILLKWRLWIFVLVADVEKMYRQVLGAEDDQPYQNVLWRENL QMPIKEFVLTTVTYGTACAPFLAKRALIEIGKECSKRNPKIQAIIQDDFYMDDLMTGA DFVLECVKIYQDISQQLDKFGFKLRKWMSNELRILEAIPDVGDNLVVRIEEGEMMKTL GVQWDPHTDNFAFYFQISEDKTLTKRKALSTLAKIFDPLGWLTPVTMLAKLFIQRLWL MDLQWDVELNAEMKQVKAC" ORIGIN 1 atgaaaaagg tctcaagaga taacggcggt aaatactatt tgccacatca agcagtagtg 61 agagaaaatc atcttactac aaaagttcgg gtagtgtttg atgcttcggc caagacaacg 121 aatggaaaaa gtttaaacga tgtcctggaa gttggtccta aactacaaca agatattttc 181 caaattttat taaaatggcg gttatggata tttgtcttgg tggcggatgt ggagaagatg 241 tacagacaag tcttaggagc ggaggacgac cagccgtacc aaaacgtatt gtggcgcgaa 301 aatctacaga tgccgattaa agagtttgtt ctaacaacag tcacctacgg gacagcatgt 361 gctccatttc tggcgaaacg agctctgatt gaaatcggga aagagtgcag caagcggaat 421 ccaaagattc aagccatcat tcaggatgac ttttacatgg atgatttgat gactggagct 481 gattttgtgc tggaatgcgt caaaatttat caggacatca gccagcaatt ggataagttt 541 ggattcaagc tgcgcaaatg gatgtccaac gagctgagaa tactagaagc aataccagat 601 gtgggcgaca atctagtcgt taggattgag gaaggcgaaa tgatgaagac gttgggtgtt 661 caatgggatc cccatacgga taattttgct ttttattttc agatcagtga agacaaaacc 721 ctaacgaagc gaaaggcgct atctacactg gccaaaatat ttgatccttt gggttggctg 781 acgcctgtaa caatgctagc caagctattc atccagaggc tatggttgat ggatttgcaa 841 tgggacgtcg agttaaacgc tgagatgaaa caagtaaaag cgtgctaa