Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013254666             552 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088952), mRNA.
ACCESSION   XM_013254666
VERSION     XM_013254666.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254666.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..552
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..552
                     /gene="LOC106088952"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106088952"
     CDS             16..510
                     /gene="LOC106088952"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013110120.2"
                     /db_xref="GeneID:106088952"
                     /translation="MSALGLFSLFVTLSIAVLNFVTAEPELFTADDGTKFLIEMEPKY
                     NWFEAVHECGRRGYQLVEVHDGDKHNTLLKSLNTYLGKSTDLWLGANDQFNDDRDLKR
                     PFYWTFSGKRMTFSNWSNDNPNNDGGQEHCVHTWEKADNFGWNDIVCTYKMGYVCEER
                     PKNC"
ORIGIN      
        1 attttatttg ttaaaatgag tgcactagga ttattttcgt tgtttgttac attatcgata
       61 gcggttttga attttgtaac ggcagagcca gaattgttca ctgcagatga tggtaccaaa
      121 tttttaattg aaatggagcc aaagtacaat tggtttgaag ctgtacatga atgtggtcgc
      181 cgtggctatc aattggttga ggtgcacgat ggtgataagc ataataccct gctgaagtct
      241 ctgaacacat atttaggtaa atctactgat ctgtggttgg gagccaacga ccaattcaat
      301 gatgatcggg atttgaagag gcccttttat tggactttct ctggcaaacg catgacattc
      361 tcaaattggt ccaatgataa tcccaacaac gacggaggcc aggagcattg tgtacataca
      421 tgggagaagg cagacaattt tggttggaat gacatagtat gcacctataa aatgggctat
      481 gtgtgtgagg aaaggccaaa aaattgttaa tagatggtta aaaataacaa aaaaaaaaaa
      541 aacaacaaaa aa