Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254666 552 bp mRNA linear INV 02-SEP-2023 (LOC106088952), mRNA. ACCESSION XM_013254666 VERSION XM_013254666.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254666.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..552 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..552 /gene="LOC106088952" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106088952" CDS 16..510 /gene="LOC106088952" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013110120.2" /db_xref="GeneID:106088952" /translation="MSALGLFSLFVTLSIAVLNFVTAEPELFTADDGTKFLIEMEPKY NWFEAVHECGRRGYQLVEVHDGDKHNTLLKSLNTYLGKSTDLWLGANDQFNDDRDLKR PFYWTFSGKRMTFSNWSNDNPNNDGGQEHCVHTWEKADNFGWNDIVCTYKMGYVCEER PKNC" ORIGIN 1 attttatttg ttaaaatgag tgcactagga ttattttcgt tgtttgttac attatcgata 61 gcggttttga attttgtaac ggcagagcca gaattgttca ctgcagatga tggtaccaaa 121 tttttaattg aaatggagcc aaagtacaat tggtttgaag ctgtacatga atgtggtcgc 181 cgtggctatc aattggttga ggtgcacgat ggtgataagc ataataccct gctgaagtct 241 ctgaacacat atttaggtaa atctactgat ctgtggttgg gagccaacga ccaattcaat 301 gatgatcggg atttgaagag gcccttttat tggactttct ctggcaaacg catgacattc 361 tcaaattggt ccaatgataa tcccaacaac gacggaggcc aggagcattg tgtacataca 421 tgggagaagg cagacaattt tggttggaat gacatagtat gcacctataa aatgggctat 481 gtgtgtgagg aaaggccaaa aaattgttaa tagatggtta aaaataacaa aaaaaaaaaa 541 aacaacaaaa aa