Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254661 579 bp mRNA linear INV 02-SEP-2023 mRNA. ACCESSION XM_013254661 VERSION XM_013254661.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254661.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 11% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..579 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..579 /gene="LOC106088947" /note="lectin subunit alpha; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:106088947" CDS 1..531 /gene="LOC106088947" /codon_start=1 /product="lectin subunit alpha" /protein_id="XP_013110115.2" /db_xref="GeneID:106088947" /translation="MSVIFEIPNMSTLKLLALCVVLLATVFDFALSEPKRYRVVHTGS TFYIETEQKYNWFQALHECARRGYKLAELQDKQKTLDLELVMQSYLDKPFNLWLGAND EFNSKQDYKRPFYWSFSGKRMTYSKWSRDNPDNYKNNEHCVHIWTERERFAWNDLDCT KKLGYVCEDKPSKVSS" ORIGIN 1 atgtcagtta tatttgagat tcccaatatg agcacattaa aacttttagc gctgtgtgta 61 gtactactgg ccacagtttt tgattttgct ctgtccgaac cgaaaaggta tcgcgtagta 121 catactggat caactttcta cattgaaacg gaacaaaagt acaattggtt ccaagcttta 181 catgaatgtg ctcgtcgtgg ttataaattg gccgaattgc aagacaaaca aaaaactttg 241 gatctggagc tagttatgca atcttatctg gataagcctt tcaatttatg gttgggtgct 301 aatgacgaat tcaactctaa gcaggactac aaaaggccat tctattggtc attctctgga 361 aaacgaatga catactccaa atggtcccgc gacaatccag acaactataa gaacaatgag 421 cactgtgttc atatatggac tgaaagagaa cggtttgctt ggaatgattt ggactgcacc 481 aaaaaactgg gctacgtttg tgaggacaaa ccctcaaaag tcagcagttg aatatattca 541 atgaaaacaa cagttcatta aatgtttcaa gattattac