Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha (LOC106088947),


LOCUS       XM_013254661             579 bp    mRNA    linear   INV 02-SEP-2023
            mRNA.
ACCESSION   XM_013254661
VERSION     XM_013254661.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254661.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 11% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..579
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..579
                     /gene="LOC106088947"
                     /note="lectin subunit alpha; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106088947"
     CDS             1..531
                     /gene="LOC106088947"
                     /codon_start=1
                     /product="lectin subunit alpha"
                     /protein_id="XP_013110115.2"
                     /db_xref="GeneID:106088947"
                     /translation="MSVIFEIPNMSTLKLLALCVVLLATVFDFALSEPKRYRVVHTGS
                     TFYIETEQKYNWFQALHECARRGYKLAELQDKQKTLDLELVMQSYLDKPFNLWLGAND
                     EFNSKQDYKRPFYWSFSGKRMTYSKWSRDNPDNYKNNEHCVHIWTERERFAWNDLDCT
                     KKLGYVCEDKPSKVSS"
ORIGIN      
        1 atgtcagtta tatttgagat tcccaatatg agcacattaa aacttttagc gctgtgtgta
       61 gtactactgg ccacagtttt tgattttgct ctgtccgaac cgaaaaggta tcgcgtagta
      121 catactggat caactttcta cattgaaacg gaacaaaagt acaattggtt ccaagcttta
      181 catgaatgtg ctcgtcgtgg ttataaattg gccgaattgc aagacaaaca aaaaactttg
      241 gatctggagc tagttatgca atcttatctg gataagcctt tcaatttatg gttgggtgct
      301 aatgacgaat tcaactctaa gcaggactac aaaaggccat tctattggtc attctctgga
      361 aaacgaatga catactccaa atggtcccgc gacaatccag acaactataa gaacaatgag
      421 cactgtgttc atatatggac tgaaagagaa cggtttgctt ggaatgattt ggactgcacc
      481 aaaaaactgg gctacgtttg tgaggacaaa ccctcaaaag tcagcagttg aatatattca
      541 atgaaaacaa cagttcatta aatgtttcaa gattattac