Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254660 777 bp mRNA linear INV 02-SEP-2023 (LOC106088946), mRNA. ACCESSION XM_013254660 VERSION XM_013254660.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254660.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..777 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..777 /gene="LOC106088946" /note="uncharacterized LOC106088946; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106088946" CDS 157..585 /gene="LOC106088946" /codon_start=1 /product="uncharacterized protein LOC106088946" /protein_id="XP_013110114.2" /db_xref="GeneID:106088946" /translation="MLKFVLILSVALALVHHETEAFKVISINTGSAPASSTAAAPALD PSALLQGVQSALASKLQQIQALVGALVQQKTALKQNALNSLQGALGGVKSQVQGLVGQ LRPPIVIRKQIYLGAPPPAATPAATTEADVDDDAATTKKE" polyA_site 777 /gene="LOC106088946" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aagctgataa attgattgag tattgtcgtg tcgtctaagc gaagcggtgg ttgtaagcgg 61 tcaaaaaaaa aatctcaata tcgtttaaca aatttcaaag atttttttta gaaaatcaga 121 atttaataga aaagcaataa aaaaaataat aagaaaatgt tgaaatttgt gttaatattg 181 agtgtggcat tggctttggt gcatcatgaa acagaagcct ttaaagtgat ttctataaat 241 acaggttcag ctcctgcttc tagtacagcc gcagctcctg ccctagatcc cagtgccctg 301 ctgcagggtg tacagtctgc cttggccagt aaactacagc agatacaggc tttagtggga 361 gccttggtgc agcaaaagac agccctgaag caaaatgctt tgaattcgct gcaaggcgct 421 ttgggcggtg tcaagagtca agttcaaggc ttagtgggtc aattgcggcc acccattgtt 481 atacgcaaac agatttacct gggagcaccg ccgccagcag ccactcccgc agcaaccaca 541 gaggccgatg tcgacgatga cgcagccaca accaaaaaag aatagaaata aaaaactaaa 601 tttttcttcc ttaagtttaa cgacatttag tgtgataaga tttttgttgg atataatcac 661 gacctgcgta cctaatcgaa gtgaataatt tttatttgcc ttaatgaaga actgtgtata 721 tacgatattg tttcgaaaat tttattaaat acattcattc aaatcaaaat aagaaaa