Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254656 614 bp mRNA linear INV 02-SEP-2023 (LOC106088943), mRNA. ACCESSION XM_013254656 VERSION XM_013254656.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254656.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..614 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..614 /gene="LOC106088943" /note="lectin subunit alpha-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:106088943" CDS 22..513 /gene="LOC106088943" /codon_start=1 /product="lectin subunit alpha-like" /protein_id="XP_013110110.1" /db_xref="GeneID:106088943" /translation="MWTLKTFSLCIVLFVTIWNCVTAEPQLHTAADGTKFYIEIEGEY NWFQALHECARRGYQLVEVHSGKKNKVLLNALDSFFGKPYNLWLGANDEFNSDRDFNR PFYWASSGKRMTFSNWSSNNPDNFRSEEHCVHTWAAREPFAWNDASCTSKMGYICEER PLA" misc_feature 124..495 /gene="LOC106088943" /note="C-type lectin (CTL)/C-type lectin-like (CTLD) domain; Region: CLECT; cd00037" /db_xref="CDD:153057" misc_feature order(406..408,421..423,427..429,445..447,454..465, 472..480) /gene="LOC106088943" /note="ligand binding surface [chemical binding]; other site" /db_xref="CDD:153057" polyA_site 614 /gene="LOC106088943" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcttttttt gatttttgaa aatgtggaca ctaaaaacat tttctctgtg cattgtatta 61 tttgtcacca tatggaattg tgtgacggca gaacctcaat tacacacagc ggctgatggt 121 acaaaattct atattgaaat agaaggagag tacaattggt tccaagcttt acatgaatgc 181 gcacgccgtg gttatcagtt ggttgaagtg cattccggca agaagaataa agttcttcta 241 aatgctctgg attctttctt tggaaaacct tataatctat ggttgggagc taatgatgag 301 tttaatagtg accgagactt taatagacca ttttattggg cctcttctgg aaaacgcatg 361 acattctcca attggtccag caataatcca gacaacttta gaagtgaaga acactgtgtg 421 catacctggg cagcgagaga accttttgct tggaacgatg catcttgcac ctcgaaaatg 481 ggatatattt gtgaggaaag gccgttggca taaattgaaa atgtttgtca catatggcaa 541 ttatttttca aatttcacag ctttatatta ttaaaaaaaa aattagcaaa aaaattaatt 601 ttgatttaaa agaa