Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans lectin subunit alpha-like


LOCUS       XM_013254656             614 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088943), mRNA.
ACCESSION   XM_013254656
VERSION     XM_013254656.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254656.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..614
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..614
                     /gene="LOC106088943"
                     /note="lectin subunit alpha-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:106088943"
     CDS             22..513
                     /gene="LOC106088943"
                     /codon_start=1
                     /product="lectin subunit alpha-like"
                     /protein_id="XP_013110110.1"
                     /db_xref="GeneID:106088943"
                     /translation="MWTLKTFSLCIVLFVTIWNCVTAEPQLHTAADGTKFYIEIEGEY
                     NWFQALHECARRGYQLVEVHSGKKNKVLLNALDSFFGKPYNLWLGANDEFNSDRDFNR
                     PFYWASSGKRMTFSNWSSNNPDNFRSEEHCVHTWAAREPFAWNDASCTSKMGYICEER
                     PLA"
     misc_feature    124..495
                     /gene="LOC106088943"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cd00037"
                     /db_xref="CDD:153057"
     misc_feature    order(406..408,421..423,427..429,445..447,454..465,
                     472..480)
                     /gene="LOC106088943"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     polyA_site      614
                     /gene="LOC106088943"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttcttttttt gatttttgaa aatgtggaca ctaaaaacat tttctctgtg cattgtatta
       61 tttgtcacca tatggaattg tgtgacggca gaacctcaat tacacacagc ggctgatggt
      121 acaaaattct atattgaaat agaaggagag tacaattggt tccaagcttt acatgaatgc
      181 gcacgccgtg gttatcagtt ggttgaagtg cattccggca agaagaataa agttcttcta
      241 aatgctctgg attctttctt tggaaaacct tataatctat ggttgggagc taatgatgag
      301 tttaatagtg accgagactt taatagacca ttttattggg cctcttctgg aaaacgcatg
      361 acattctcca attggtccag caataatcca gacaacttta gaagtgaaga acactgtgtg
      421 catacctggg cagcgagaga accttttgct tggaacgatg catcttgcac ctcgaaaatg
      481 ggatatattt gtgaggaaag gccgttggca taaattgaaa atgtttgtca catatggcaa
      541 ttatttttca aatttcacag ctttatatta ttaaaaaaaa aattagcaaa aaaattaatt
      601 ttgatttaaa agaa