Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans histidine-rich glycoprotein-like


LOCUS       XM_013254610             840 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088902), mRNA.
ACCESSION   XM_013254610
VERSION     XM_013254610.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254610.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..840
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..840
                     /gene="LOC106088902"
                     /note="histidine-rich glycoprotein-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:106088902"
     CDS             1..840
                     /gene="LOC106088902"
                     /codon_start=1
                     /product="histidine-rich glycoprotein-like"
                     /protein_id="XP_013110064.2"
                     /db_xref="GeneID:106088902"
                     /translation="MKAFIWIFATFIVTSSAGFIGSGGSRALGSGGIGGHRTGDVDTV
                     VVHHHHGGFSGDHFHTGHPEVQTVKVIHHDVATSSHLGGAPGFDGHGNQYGGFTSTAG
                     VGLVKTVNIIHQHGSHGFGGFNGGFASDHSHVGAPHHEVKTIKVIHEEDGHSQIGGFT
                     GGIHDHPHGSHHEVKTVKVIHQDAGHAHGASFAGGLDHSSYGYDHSLVGHHATKTIKV
                     FHQLAGQDHRHVGHDQGHVANTAAPLSPVAHHEVKTINVIHHAEPPSNSYLPPVSTPI
                     DFN"
ORIGIN      
        1 atgaaggctt ttatctggat ctttgccaca tttattgtta cttcctccgc cggatttata
       61 ggcagtggtg gaagtagagc attgggaagc ggtggcattg gtggtcaccg tactggtgac
      121 gtggacacag ttgttgttca tcaccaccac ggaggatttt ccggagatca ttttcacaca
      181 ggacacccgg aagttcaaac tgtcaaggtt atacatcacg atgtggctac aagttcacac
      241 ttaggtggag ctcctggttt cgatggtcat ggtaatcaat atggcggttt cacttcgact
      301 gctggtgttg gtcttgttaa aacagttaat ataattcatc aacatggtag tcacggattc
      361 ggtggattta atggaggatt tgcctctgat cattctcatg ttggagctcc tcatcacgag
      421 gttaaaacta ttaaagtaat ccatgaagaa gatggccact cacaaattgg tggttttact
      481 ggtggaatac atgaccaccc acatggtagt caccatgaag tcaaaacagt taaagtaatt
      541 catcaggatg ccgggcatgc acacggtgca agttttgctg gaggtctaga tcactcctcc
      601 tatggctacg atcattcttt agttggtcat catgcaacca aaaccattaa agtttttcat
      661 caattggctg gccaagatca tagacacgtt ggtcacgatc aaggtcatgt tgctaatacc
      721 gcagctcctc tatcgcctgt agcccatcac gaagtcaaga ctatcaatgt catccaccat
      781 gcagaaccgc caagtaactc gtatttgcca ccagtctcga caccaataga ctttaactaa