Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088901


LOCUS       XM_013254609            1389 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088901), mRNA.
ACCESSION   XM_013254609
VERSION     XM_013254609.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254609.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1389
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1389
                     /gene="LOC106088901"
                     /note="uncharacterized LOC106088901; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:106088901"
     CDS             1..1389
                     /gene="LOC106088901"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088901"
                     /protein_id="XP_013110063.2"
                     /db_xref="GeneID:106088901"
                     /translation="MIGISTAGFIGSSSGGGGGGVYGGGGGGFGGGHGGGYGGDRGGS
                     VRTIKVVHAAGGSGAGGHGGHGGYGGHGGRAGGPVQTIKVLHAQSDSSTGGHGGHGGY
                     GGYTSHGAGGAGGAVTIKVIHAEGSAGAGGHGGHGGYSSPGAGSHGGHGGHVGGVRTI
                     KVIHEQGGASAGHGGYSAGGNGAGAGEVKTIQVIHEQGGASAGGHGGYNSGGGGGGFS
                     AGGYRGAEEVKTIQVIHEGSTASAGQGGYSRGGGHDGFSADGAAGGYGGGEEVKTIQV
                     VHEQGGAGGSGIGFSAGGGAGGYGSGETVKTIKIIHEQGGDGVGGAGGFSANAGGYGG
                     NDDVKTIQVIHEQGSTGGSGFSAGGGASGGFSAGGGAGGEEVGTIQVIHEDGGSSAGA
                     YSSGGGYSDGGGYSSGGDYSAAAAAGGFDDTFETLKSLKVIGALSVDGGSGGAGAISS
                     GYVAAPDGGWQV"
ORIGIN      
        1 atgataggta taagcaccgc cggctttatt ggcagtagtt ctggaggcgg tggtggagga
       61 gtatatggtg gcggcggagg aggcttcggt ggcggtcatg gaggtggtta tggtggtgat
      121 cgtggaggct ccgttcgaac cattaaagtt gttcacgccg ctggtggctc cggtgctgga
      181 ggtcatggtg gtcacggagg ttatggcgga catggcggtc gtgccggagg acctgtccaa
      241 actataaaag ttcttcatgc tcaaagcgac tcttcaactg gcggccatgg aggtcacggc
      301 ggttatggag gatacaccag tcatggtgct ggcggtgccg gaggtgcagt aaccattaaa
      361 gttattcatg ctgaaggttc tgcgggagct ggtgggcacg gaggtcatgg aggctacagt
      421 agtcctggag ctggtagtca cggcggtcat ggaggtcacg ttggtggtgt tagaaccata
      481 aaggtgattc atgagcaagg tggtgcttca gctggtcacg gtgggtactc tgccggaggt
      541 aatggcgctg gagctggaga agttaaaacc atccaagtta tacatgaaca aggtggtgct
      601 tctgctggtg gtcatggtgg atacaatagt ggaggtggcg gtggtggttt ctctgctggt
      661 ggctatagag gagctgagga ggtcaaaaca attcaagtca tccatgaggg aagcactgct
      721 tctgctgggc aaggtggcta ctctcgcggc ggtggtcatg atggattttc tgctgatggt
      781 gccgctggtg gctatggagg tggcgaagaa gtaaaaacca ttcaagttgt ccacgaacaa
      841 ggtggtgctg gtggatccgg cattggattc tctgctggtg gaggtgctgg aggctacggc
      901 agtggtgaaa cagttaaaac tattaaaatt atccatgaac aaggaggtga tggtgttgga
      961 ggtgccggtg gattctctgc taatgctggt ggctatggag gaaatgatga tgtaaaaacc
     1021 attcaagtta tccacgaaca aggtagtacc ggtggaagtg gtttctctgc tggtggcggc
     1081 gctagcggtg gattctcggc tggcggaggt gccggtggtg aagaagtcgg aactattcaa
     1141 gtcattcatg aggatggggg ttcatcagct ggtgcttatt cttctggcgg cggttattct
     1201 gatggcggtg gctattcttc tggcggtgac tattctgctg ctgccgcagc aggtggcttt
     1261 gatgatacct tcgaaactct caaatccctt aaggttattg gtgccttaag tgtcgatggc
     1321 ggctctggtg gagctggtgc catttccagt ggctacgtag cagccccaga cggaggttgg
     1381 caagtgtaa