Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254609 1389 bp mRNA linear INV 02-SEP-2023 (LOC106088901), mRNA. ACCESSION XM_013254609 VERSION XM_013254609.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq; includes ab initio. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254609.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1389 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1389 /gene="LOC106088901" /note="uncharacterized LOC106088901; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:106088901" CDS 1..1389 /gene="LOC106088901" /codon_start=1 /product="uncharacterized protein LOC106088901" /protein_id="XP_013110063.2" /db_xref="GeneID:106088901" /translation="MIGISTAGFIGSSSGGGGGGVYGGGGGGFGGGHGGGYGGDRGGS VRTIKVVHAAGGSGAGGHGGHGGYGGHGGRAGGPVQTIKVLHAQSDSSTGGHGGHGGY GGYTSHGAGGAGGAVTIKVIHAEGSAGAGGHGGHGGYSSPGAGSHGGHGGHVGGVRTI KVIHEQGGASAGHGGYSAGGNGAGAGEVKTIQVIHEQGGASAGGHGGYNSGGGGGGFS AGGYRGAEEVKTIQVIHEGSTASAGQGGYSRGGGHDGFSADGAAGGYGGGEEVKTIQV VHEQGGAGGSGIGFSAGGGAGGYGSGETVKTIKIIHEQGGDGVGGAGGFSANAGGYGG NDDVKTIQVIHEQGSTGGSGFSAGGGASGGFSAGGGAGGEEVGTIQVIHEDGGSSAGA YSSGGGYSDGGGYSSGGDYSAAAAAGGFDDTFETLKSLKVIGALSVDGGSGGAGAISS GYVAAPDGGWQV" ORIGIN 1 atgataggta taagcaccgc cggctttatt ggcagtagtt ctggaggcgg tggtggagga 61 gtatatggtg gcggcggagg aggcttcggt ggcggtcatg gaggtggtta tggtggtgat 121 cgtggaggct ccgttcgaac cattaaagtt gttcacgccg ctggtggctc cggtgctgga 181 ggtcatggtg gtcacggagg ttatggcgga catggcggtc gtgccggagg acctgtccaa 241 actataaaag ttcttcatgc tcaaagcgac tcttcaactg gcggccatgg aggtcacggc 301 ggttatggag gatacaccag tcatggtgct ggcggtgccg gaggtgcagt aaccattaaa 361 gttattcatg ctgaaggttc tgcgggagct ggtgggcacg gaggtcatgg aggctacagt 421 agtcctggag ctggtagtca cggcggtcat ggaggtcacg ttggtggtgt tagaaccata 481 aaggtgattc atgagcaagg tggtgcttca gctggtcacg gtgggtactc tgccggaggt 541 aatggcgctg gagctggaga agttaaaacc atccaagtta tacatgaaca aggtggtgct 601 tctgctggtg gtcatggtgg atacaatagt ggaggtggcg gtggtggttt ctctgctggt 661 ggctatagag gagctgagga ggtcaaaaca attcaagtca tccatgaggg aagcactgct 721 tctgctgggc aaggtggcta ctctcgcggc ggtggtcatg atggattttc tgctgatggt 781 gccgctggtg gctatggagg tggcgaagaa gtaaaaacca ttcaagttgt ccacgaacaa 841 ggtggtgctg gtggatccgg cattggattc tctgctggtg gaggtgctgg aggctacggc 901 agtggtgaaa cagttaaaac tattaaaatt atccatgaac aaggaggtga tggtgttgga 961 ggtgccggtg gattctctgc taatgctggt ggctatggag gaaatgatga tgtaaaaacc 1021 attcaagtta tccacgaaca aggtagtacc ggtggaagtg gtttctctgc tggtggcggc 1081 gctagcggtg gattctcggc tggcggaggt gccggtggtg aagaagtcgg aactattcaa 1141 gtcattcatg aggatggggg ttcatcagct ggtgcttatt cttctggcgg cggttattct 1201 gatggcggtg gctattcttc tggcggtgac tattctgctg ctgccgcagc aggtggcttt 1261 gatgatacct tcgaaactct caaatccctt aaggttattg gtgccttaag tgtcgatggc 1321 ggctctggtg gagctggtgc catttccagt ggctacgtag cagccccaga cggaggttgg 1381 caagtgtaa