Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088840


LOCUS       XM_013254540             985 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088840), mRNA.
ACCESSION   XM_013254540
VERSION     XM_013254540.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254540.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..985
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..985
                     /gene="LOC106088840"
                     /note="uncharacterized LOC106088840; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106088840"
     CDS             90..749
                     /gene="LOC106088840"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088840"
                     /protein_id="XP_013109994.2"
                     /db_xref="GeneID:106088840"
                     /translation="MENLNAIILPRVLQMVNNTPNLCESLDHVCMTMKRCLAAEAKGS
                     IRSINVREAVKEALNVAENLGIVKLKENMVRLPFRINSGVEAYNSNKQHVENESAEAE
                     EVYNDPPATSSFAMSSSQTKKKYSGKFLNTDPEVEDVSSEDEGAEEELGKDPPKSGQS
                     NRQIKKKISKMNDDPEDCYGRGRSSTMRQRRAKRPKSGKTENRSRSRSSRRRGSRRRR
                     S"
     polyA_site      985
                     /gene="LOC106088840"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cattatattt gtgaagctct attgggaaac attgagtgat taaaataatt tttcgatttt
       61 tttttttttt ggaacttaaa tgtggaaata tggaaaattt aaacgccatc atattacctc
      121 gcgtattaca aatggtcaac aatacaccaa atttatgtga gtcattggac catgtatgta
      181 tgaccatgaa acgatgcttg gctgcggaag cgaaaggatc gattcgctcc atcaatgtac
      241 gtgaggccgt taaggaagct ctgaatgtgg ctgaaaatct tggaattgtc aagctgaaag
      301 aaaacatggt gagactaccg tttaggatca attctggcgt ggaggcttat aattctaata
      361 aacaacacgt agaaaacgaa agtgcagaag ccgaagaggt atataatgat ccacctgcaa
      421 caagcagctt cgccatgtca tccagccaaa cgaaaaagaa atattctgga aaatttctga
      481 ataccgatcc agaagtagag gatgtaagtt cagaagatga aggtgcagaa gaagagttag
      541 gcaaagatcc acctaaatct ggacaatcaa acaggcaaat taaaaagaaa atttctaaaa
      601 tgaatgacga tcccgaggat tgctatggca gaggcagatc atcgaccatg cgccaacgac
      661 gtgcaaagag accaaaaagc gggaagaccg aaaatcgcag tcgaagtcgc agtagccgtc
      721 gacgtggatc ccggagaagg cgttcttaaa tgttgttatt gttcaaattt tataaaatgt
      781 agaaacgaat ttaattagac catttaaaaa ttaacaagta agagcctgct aagttcggcc
      841 tggccggatc ttatacaccc tccaccatgg atcgcatttg tcgagttcca tgtgcggtat
      901 ctttttttta ggcaaacaaa taatattgaa taacaactgt tttgctattg gagctatatc
      961 aaataatagt tcgattcgga tcata