Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254540 985 bp mRNA linear INV 02-SEP-2023 (LOC106088840), mRNA. ACCESSION XM_013254540 VERSION XM_013254540.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254540.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..985 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..985 /gene="LOC106088840" /note="uncharacterized LOC106088840; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106088840" CDS 90..749 /gene="LOC106088840" /codon_start=1 /product="uncharacterized protein LOC106088840" /protein_id="XP_013109994.2" /db_xref="GeneID:106088840" /translation="MENLNAIILPRVLQMVNNTPNLCESLDHVCMTMKRCLAAEAKGS IRSINVREAVKEALNVAENLGIVKLKENMVRLPFRINSGVEAYNSNKQHVENESAEAE EVYNDPPATSSFAMSSSQTKKKYSGKFLNTDPEVEDVSSEDEGAEEELGKDPPKSGQS NRQIKKKISKMNDDPEDCYGRGRSSTMRQRRAKRPKSGKTENRSRSRSSRRRGSRRRR S" polyA_site 985 /gene="LOC106088840" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cattatattt gtgaagctct attgggaaac attgagtgat taaaataatt tttcgatttt 61 tttttttttt ggaacttaaa tgtggaaata tggaaaattt aaacgccatc atattacctc 121 gcgtattaca aatggtcaac aatacaccaa atttatgtga gtcattggac catgtatgta 181 tgaccatgaa acgatgcttg gctgcggaag cgaaaggatc gattcgctcc atcaatgtac 241 gtgaggccgt taaggaagct ctgaatgtgg ctgaaaatct tggaattgtc aagctgaaag 301 aaaacatggt gagactaccg tttaggatca attctggcgt ggaggcttat aattctaata 361 aacaacacgt agaaaacgaa agtgcagaag ccgaagaggt atataatgat ccacctgcaa 421 caagcagctt cgccatgtca tccagccaaa cgaaaaagaa atattctgga aaatttctga 481 ataccgatcc agaagtagag gatgtaagtt cagaagatga aggtgcagaa gaagagttag 541 gcaaagatcc acctaaatct ggacaatcaa acaggcaaat taaaaagaaa atttctaaaa 601 tgaatgacga tcccgaggat tgctatggca gaggcagatc atcgaccatg cgccaacgac 661 gtgcaaagag accaaaaagc gggaagaccg aaaatcgcag tcgaagtcgc agtagccgtc 721 gacgtggatc ccggagaagg cgttcttaaa tgttgttatt gttcaaattt tataaaatgt 781 agaaacgaat ttaattagac catttaaaaa ttaacaagta agagcctgct aagttcggcc 841 tggccggatc ttatacaccc tccaccatgg atcgcatttg tcgagttcca tgtgcggtat 901 ctttttttta ggcaaacaaa taatattgaa taacaactgt tttgctattg gagctatatc 961 aaataatagt tcgattcgga tcata