Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254341 529 bp mRNA linear INV 02-SEP-2023 (LOC106088690), mRNA. ACCESSION XM_013254341 VERSION XM_013254341.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254341.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..529 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..529 /gene="LOC106088690" /note="uncharacterized LOC106088690; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106088690" CDS 10..528 /gene="LOC106088690" /codon_start=1 /product="uncharacterized protein LOC106088690" /protein_id="XP_013109795.2" /db_xref="GeneID:106088690" /translation="MKLICIFALVLIASVQANQNRCRPVCRAKQHSRAICATDGQQKI CHRMSQCKMEEENCRRRSANKPLLSNVADTRCRNIRGPNMRGACAKPVRSPRSTPIDC SSLRCTNPSKELKCYRCSHDLCQRLTPCQLQRINCERGRSNRLTLANSFQCAGMKSGQ SLQKCKPIRRRG" ORIGIN 1 ttcgcaatca tgaaacttat ttgcattttt gccttagtcc tgatcgccag cgttcaggct 61 aaccaaaatc gttgtcgccc cgtatgccgt gccaaacagc acagcagggc catatgtgcc 121 accgatggcc agcaaaagat ttgccatcgc atgtctcaat gcaaaatgga ggaggagaat 181 tgtcgccgtc gcagtgccaa taagccatta ctttccaatg tcgctgatac acgttgtcgc 241 aacattcgag gtcccaacat gaggggtgcc tgtgctaagc ctgtgcgttc accacgttcc 301 acaccaattg actgcagtag tttgagatgc accaatccca gcaaagaatt gaaatgttat 361 cgttgcagtc atgatctgtg ccaacgtttg acaccctgtc aattgcaacg catcaattgt 421 gaacgtggtc gatcgaatcg cttgactttg gccaatagtt tccaatgtgc tggcatgaaa 481 agtggccaat ctttgcagaa atgcaaacct atacgcagaa ggggttaaa