Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088690


LOCUS       XM_013254341             529 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088690), mRNA.
ACCESSION   XM_013254341
VERSION     XM_013254341.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254341.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..529
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..529
                     /gene="LOC106088690"
                     /note="uncharacterized LOC106088690; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106088690"
     CDS             10..528
                     /gene="LOC106088690"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088690"
                     /protein_id="XP_013109795.2"
                     /db_xref="GeneID:106088690"
                     /translation="MKLICIFALVLIASVQANQNRCRPVCRAKQHSRAICATDGQQKI
                     CHRMSQCKMEEENCRRRSANKPLLSNVADTRCRNIRGPNMRGACAKPVRSPRSTPIDC
                     SSLRCTNPSKELKCYRCSHDLCQRLTPCQLQRINCERGRSNRLTLANSFQCAGMKSGQ
                     SLQKCKPIRRRG"
ORIGIN      
        1 ttcgcaatca tgaaacttat ttgcattttt gccttagtcc tgatcgccag cgttcaggct
       61 aaccaaaatc gttgtcgccc cgtatgccgt gccaaacagc acagcagggc catatgtgcc
      121 accgatggcc agcaaaagat ttgccatcgc atgtctcaat gcaaaatgga ggaggagaat
      181 tgtcgccgtc gcagtgccaa taagccatta ctttccaatg tcgctgatac acgttgtcgc
      241 aacattcgag gtcccaacat gaggggtgcc tgtgctaagc ctgtgcgttc accacgttcc
      301 acaccaattg actgcagtag tttgagatgc accaatccca gcaaagaatt gaaatgttat
      361 cgttgcagtc atgatctgtg ccaacgtttg acaccctgtc aattgcaacg catcaattgt
      421 gaacgtggtc gatcgaatcg cttgactttg gccaatagtt tccaatgtgc tggcatgaaa
      481 agtggccaat ctttgcagaa atgcaaacct atacgcagaa ggggttaaa