PREDICTED: Stomoxys calcitrans uncharacterized LOC106088688

LOCUS       XM_013254339             336 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088688), mRNA.
ACCESSION   XM_013254339
VERSION     XM_013254339.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254339.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..336
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..336
                     /gene="LOC106088688"
                     /note="uncharacterized LOC106088688; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:106088688"
     CDS             1..336
                     /gene="LOC106088688"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088688"
                     /protein_id="XP_013109793.2"
                     /db_xref="GeneID:106088688"
                     /translation="MKFITAVCIVIVMALVPSLKAARICVIQSANCNTTTGTNVCGRY
                     GRSTLCMRFRNTCALQTANCTDNVGYTAVSLANCRNIALNQRAVCGSSSTSSSNVQPV
                     IVNLGNTGK"
ORIGIN      
        1 atgaaattta taactgccgt atgcattgta atcgtcatgg ccctggtgcc atccttaaag
       61 gctgcccgta tctgtgttat ccaaagtgcc aattgcaaca ccaccactgg aacaaatgtt
      121 tgcggtcgtt atggtcgctc tactctttgc atgcgattca gaaatacttg tgccctgcaa
      181 acggccaatt gtaccgacaa tgttggttac acagctgtaa gtctagccaa ctgcagaaat
      241 attgctctca atcaacgcgc cgtatgtggc agcagttcaa cgagtagtag caatgttcag
      301 cccgttattg taaatctagg aaatacagga aaataa