Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans frataxin homolog, mitochondrial


LOCUS       XM_013254253             665 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088641), mRNA.
ACCESSION   XM_013254253
VERSION     XM_013254253.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254253.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..665
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..665
                     /gene="LOC106088641"
                     /note="frataxin homolog, mitochondrial; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 11 Proteins"
                     /db_xref="GeneID:106088641"
     CDS             25..588
                     /gene="LOC106088641"
                     /codon_start=1
                     /product="frataxin homolog, mitochondrial"
                     /protein_id="XP_013109707.2"
                     /db_xref="GeneID:106088641"
                     /translation="MYGRLAANFLLRNIAKNQRNLRYLSVIKCCSLPRTIVATNYTAP
                     QRKYSSTKQPTEHVVDSILDHATYERVCAETLDGLNDYFEQLMESIDNIPGSDLAYSD
                     GVLTVNLGEHGTYVINRQTPNRQIWLSSPTSGPKRYDFVGESSGATGKWIYRHNSQSL
                     HELLQLELQKVFETQKLEFEDLPFGGR"
     polyA_site      665
                     /gene="LOC106088641"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttataatt cgaaaaataa aaaaatgtac ggccggctag cagcaaattt tttgcttagg
       61 aatatagcaa aaaatcaaag aaatttgaga tatttgtctg taataaaatg ctgcagttta
      121 ccccggacca ttgttgcaac aaattataca gcaccacaac gtaaatactc atccacaaaa
      181 cagcccacag agcatgtagt cgattctata ctcgatcatg caacatatga acgggtatgt
      241 gccgagacct tagatgggct aaatgactac tttgagcaat tgatggaaag cattgacaat
      301 ataccaggca gtgatttggc ttatagtgat ggtgtcttga ctgttaactt gggcgaacat
      361 ggcacctatg ttataaatcg ccaaacacct aaccgtcaaa tatggttaag ctcacctacc
      421 agtggtccta agcgttatga ttttgtgggc gaatcatcag gtgcaactgg caaatggatc
      481 tatcgtcata atagtcagtc attacatgaa cttttgcagc tagaattaca aaaagttttc
      541 gaaacccaaa aactagaatt cgaagattta ccatttggcg gcagatgaaa tgacatagga
      601 tttaatttta gaacaattca aacaaggtaa taaaaatcat aatgctggag gcattctttt
      661 aataa