Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254253 665 bp mRNA linear INV 02-SEP-2023 (LOC106088641), mRNA. ACCESSION XM_013254253 VERSION XM_013254253.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254253.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..665 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..665 /gene="LOC106088641" /note="frataxin homolog, mitochondrial; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins" /db_xref="GeneID:106088641" CDS 25..588 /gene="LOC106088641" /codon_start=1 /product="frataxin homolog, mitochondrial" /protein_id="XP_013109707.2" /db_xref="GeneID:106088641" /translation="MYGRLAANFLLRNIAKNQRNLRYLSVIKCCSLPRTIVATNYTAP QRKYSSTKQPTEHVVDSILDHATYERVCAETLDGLNDYFEQLMESIDNIPGSDLAYSD GVLTVNLGEHGTYVINRQTPNRQIWLSSPTSGPKRYDFVGESSGATGKWIYRHNSQSL HELLQLELQKVFETQKLEFEDLPFGGR" polyA_site 665 /gene="LOC106088641" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttttataatt cgaaaaataa aaaaatgtac ggccggctag cagcaaattt tttgcttagg 61 aatatagcaa aaaatcaaag aaatttgaga tatttgtctg taataaaatg ctgcagttta 121 ccccggacca ttgttgcaac aaattataca gcaccacaac gtaaatactc atccacaaaa 181 cagcccacag agcatgtagt cgattctata ctcgatcatg caacatatga acgggtatgt 241 gccgagacct tagatgggct aaatgactac tttgagcaat tgatggaaag cattgacaat 301 ataccaggca gtgatttggc ttatagtgat ggtgtcttga ctgttaactt gggcgaacat 361 ggcacctatg ttataaatcg ccaaacacct aaccgtcaaa tatggttaag ctcacctacc 421 agtggtccta agcgttatga ttttgtgggc gaatcatcag gtgcaactgg caaatggatc 481 tatcgtcata atagtcagtc attacatgaa cttttgcagc tagaattaca aaaagttttc 541 gaaacccaaa aactagaatt cgaagattta ccatttggcg gcagatgaaa tgacatagga 601 tttaatttta gaacaattca aacaaggtaa taaaaatcat aatgctggag gcattctttt 661 aataa