Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254251 1364 bp mRNA linear INV 02-SEP-2023 (LOC106088639), mRNA. ACCESSION XM_013254251 VERSION XM_013254251.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254251.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1364 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..1364 /gene="LOC106088639" /note="protein MAK16 homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins" /db_xref="GeneID:106088639" CDS 131..1183 /gene="LOC106088639" /codon_start=1 /product="protein MAK16 homolog" /protein_id="XP_013109705.1" /db_xref="GeneID:106088639" /translation="MQHDDVVWSIINKSFCSHKVKTDTRTFCRHEYNLTGLCTRRTCP LANSQYATVREEKGIIYLYMKTAERAHMPNKLWERVKLSRNFEKAIEQINENLVFWPK YMIAKNKQRFLKITQYLIRMRKLKLRRQKLIVPLSRKIERRETRREQKALIAAKIENH IEKELMERLKRGTYQDIYNFSQTAFNKALAAEEVEDDEEVEEDMEEEQELEHEMDDEA RELRKNLLDEEFVEADSEEEIDDDEGDDDEYSDDEDAISESGEKEEVEVDSDFENSDE DVGSDIEDTPAAGAFVRAPAKSPSKTIASKSSASAARKTNGASTANKTKRRLKKPKVE IEYEMETEANRQRIHN" misc_feature 131..697 /gene="LOC106088639" /note="Protein MAK16 homolog; Provisional; Region: PLN00040" /db_xref="CDD:215038" polyA_site 1364 /gene="LOC106088639" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttcgctaagt gtcaagtttg aaaataaaaa caactcgaaa agctgagaac ctgcacgtgt 61 tggtttctga cgattgtaac attttgtttt tagttgttta aatacatttt taaattaaaa 121 ttaagttaaa atgcagcacg atgatgttgt ttggagcatc atcaacaaat cattctgttc 181 acacaaagtc aaaactgata cacgtacatt ctgtcgccat gaatacaatc ttacaggctt 241 gtgtactcga cgaacctgtc ccttggccaa ttcacaatat gccactgttc gtgaagagaa 301 gggcataatc tatctttata tgaaaacggc ggagagagct cacatgccca acaaattatg 361 ggaacgtgta aagctatcgc gaaattttga aaaggccata gaacaaatca atgaaaatct 421 ggtcttttgg ccaaaataca tgattgccaa gaataagcag agatttttga aaatcaccca 481 atatttgata cgtatgcgta aattgaaatt aagaagacaa aaacttattg taccactatc 541 gaggaaaatt gaacgccgtg agacacgtcg tgagcagaag gctctaatag cggccaagat 601 tgagaaccac atagaaaagg aattgatgga acgtttgaaa cgtggcacat accaggatat 661 ctataatttc tcacagacgg ccttcaacaa agcgttggca gccgaggaag ttgaggatga 721 tgaagaagtt gaagaagata tggaggagga acaggagtta gaacacgaga tggatgatga 781 agctagagag ttgcgaaaaa atttgctcga tgaggagttt gttgaggctg attcggagga 841 agaaatcgat gatgacgaag gtgatgacga tgaatacagt gatgatgagg atgctattag 901 tgaatctggt gaaaaggaag aagtggaagt tgatagtgat tttgagaatt ctgacgaaga 961 tgttggttcc gatattgagg atacaccagc ggcaggcgcc tttgttcgag ctcccgccaa 1021 atctccatcg aaaaccattg ccagcaaatc atcagcatcc gccgcacgta aaacaaatgg 1081 tgcatctacc gcaaataaaa caaagcgacg gcttaaaaag cctaaagtcg aaattgaata 1141 tgaaatggag accgaggcaa accggcaaag gatacataac tgaggtagtt gttgctattg 1201 cagccgacac acagactgca atttctattt ttttattata atttaaagca aaactctttc 1261 atttttctaa aaatgtacct acctacccta acgataactt tttatttctt tataaagaag 1321 aaaacaagta aaaaaaataa attcaaactt agttaatata tgaa