Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013254134 545 bp mRNA linear INV 02-SEP-2023 (LOC106088557), mRNA. ACCESSION XM_013254134 VERSION XM_013254134.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013254134.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..545 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..545 /gene="LOC106088557" /note="uncharacterized LOC106088557; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 4 Proteins" /db_xref="GeneID:106088557" CDS 87..428 /gene="LOC106088557" /codon_start=1 /product="uncharacterized protein LOC106088557" /protein_id="XP_013109588.2" /db_xref="GeneID:106088557" /translation="MFSAKYILLLVSCVILVASSPVELEEDVDYIHSIPEEYGVRHLS RHARSPQHGSVDIGYSKDQRGREASVQYNHNLYTSRDGRGSIDAYAQGSRNFDHNRNS FGGGIQGKWRF" polyA_site 545 /gene="LOC106088557" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 atatatatac tcgtaaaaca ctcaaaacag caatttaaac atcacttgaa aataatcaga 61 actacgagca atttgctgaa ataaaaatgt tctctgccaa gtatatcctt cttttggtat 121 cgtgtgtgat actcgtcgca tcatcacctg tggaattgga agaagatgtt gattacatac 181 attcgattcc agaagaatat ggagtgcggc atttgtcacg tcatgcacgt tctcctcaac 241 atggaagtgt agacattgga tacagcaagg atcaacgcgg acgtgaagcc tctgttcaat 301 ataaccataa cttgtacacc agtcgcgatg gtcgtggttc catcgatgcc tatgcccagg 361 gtagccgtaa ttttgatcac aatcgcaata gctttggcgg tggtattcaa ggaaagtgga 421 ggttttaatt gtgttttgta ttaaagatac tatacggatt atagtatgct gtgttaagat 481 tttaataaaa ttaacaaatg agtaaatccc ttaataaaga tagtgtaagc acatatctag 541 tataa