Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans uncharacterized LOC106088557


LOCUS       XM_013254134             545 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088557), mRNA.
ACCESSION   XM_013254134
VERSION     XM_013254134.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013254134.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..545
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..545
                     /gene="LOC106088557"
                     /note="uncharacterized LOC106088557; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     ESTs, 4 Proteins"
                     /db_xref="GeneID:106088557"
     CDS             87..428
                     /gene="LOC106088557"
                     /codon_start=1
                     /product="uncharacterized protein LOC106088557"
                     /protein_id="XP_013109588.2"
                     /db_xref="GeneID:106088557"
                     /translation="MFSAKYILLLVSCVILVASSPVELEEDVDYIHSIPEEYGVRHLS
                     RHARSPQHGSVDIGYSKDQRGREASVQYNHNLYTSRDGRGSIDAYAQGSRNFDHNRNS
                     FGGGIQGKWRF"
     polyA_site      545
                     /gene="LOC106088557"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atatatatac tcgtaaaaca ctcaaaacag caatttaaac atcacttgaa aataatcaga
       61 actacgagca atttgctgaa ataaaaatgt tctctgccaa gtatatcctt cttttggtat
      121 cgtgtgtgat actcgtcgca tcatcacctg tggaattgga agaagatgtt gattacatac
      181 attcgattcc agaagaatat ggagtgcggc atttgtcacg tcatgcacgt tctcctcaac
      241 atggaagtgt agacattgga tacagcaagg atcaacgcgg acgtgaagcc tctgttcaat
      301 ataaccataa cttgtacacc agtcgcgatg gtcgtggttc catcgatgcc tatgcccagg
      361 gtagccgtaa ttttgatcac aatcgcaata gctttggcgg tggtattcaa ggaaagtgga
      421 ggttttaatt gtgttttgta ttaaagatac tatacggatt atagtatgct gtgttaagat
      481 tttaataaaa ttaacaaatg agtaaatccc ttaataaaga tagtgtaagc acatatctag
      541 tataa