Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans N-alpha-acetyltransferase 20


LOCUS       XM_013253431             944 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088112), transcript variant X1, mRNA.
ACCESSION   XM_013253431
VERSION     XM_013253431.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253431.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..944
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..944
                     /gene="LOC106088112"
                     /note="N-alpha-acetyltransferase 20; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106088112"
     CDS             251..799
                     /gene="LOC106088112"
                     /codon_start=1
                     /product="N-alpha-acetyltransferase 20"
                     /protein_id="XP_013108885.1"
                     /db_xref="GeneID:106088112"
                     /translation="MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLARWPEFFQ
                     LAESPSGQIMGYIMGKVEGHMENWHGHVTALTVSPDYRRLGLAALLMNFLEDISEKKR
                     AYFVDLFVRKSNKIAINMYTNLGYIIFRTILDYYSGDQDEDAYDMRKALTRDTEKKSI
                     IPYTQPVSKRELRHYMENTNYC"
     misc_feature    413..706
                     /gene="LOC106088112"
                     /note="Ribosomal protein S18 acetylase RimI and related
                     acetyltransferases [Translation, ribosomal structure and
                     biogenesis]; Region: RimI; COG0456"
                     /db_xref="CDD:440224"
     polyA_site      944
                     /gene="LOC106088112"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attacttttg ttttagagta cattttaatc tcttattaat tgccatcttt aatagaacaa
       61 aaaactcaca atttttatcc tggtaatcga aaactcacaa acgagcagaa ttctacgcca
      121 tttctcatca ctatcagact tgtttttaat aaacttggag cgaaatttgt gcatggtggc
      181 taatccaaaa ataaatcgag agaagcacca cagcagattt ttgttgctat aggaatccta
      241 tttcaccagt atgaccactc tgagaccttt tacttgcgat gacttattta aattcaataa
      301 tgtgaacttt gaccccttaa cagaaacata tggtctttcg ttttatacac agtatcttgc
      361 tcgttggcca gaattttttc aattagcgga atcgcccagt ggccagataa tgggatacat
      421 aatgggaaaa gttgaaggac atatggagaa ttggcatggc catgtaacag ctttaaccgt
      481 gtcacctgac taccgccgtt tgggcttagc agctctgtta atgaacttct tggaagacat
      541 atctgaaaag aagcgagctt attttgttga cttatttgtt cgcaaaagta acaaaattgc
      601 cataaacatg tataccaatt taggatatat aatatttcga acaatattgg actactattc
      661 tggagatcaa gacgaagatg cctatgatat gcgaaaagca ctcacaaggg acacggagaa
      721 gaaatctata ataccataca cacaaccagt atcgaaaagg gagttacgac attatatgga
      781 gaatacaaac tattgttgac aagatagtcg aaggaaaaga gcaaatcaat tcttcaagtt
      841 agctaattgg atgcattagc attttatgaa aatataccaa taaatctttg atttgcctgc
      901 attagattaa caacaaataa aatttttttg atttaaaatc gaaa