Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans TM2 domain-containing protein


LOCUS       XM_013253322             886 bp    mRNA    linear   INV 02-SEP-2023
            almondex (LOC106088036), mRNA.
ACCESSION   XM_013253322
VERSION     XM_013253322.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253322.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..886
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..886
                     /gene="LOC106088036"
                     /note="TM2 domain-containing protein almondex; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106088036"
     CDS             75..782
                     /gene="LOC106088036"
                     /codon_start=1
                     /product="TM2 domain-containing protein almondex"
                     /protein_id="XP_013108776.1"
                     /db_xref="GeneID:106088036"
                     /translation="MSHCIVIDRRNAIMLIWIFVLSGIRQSYTEEKASGVAPSNNEVA
                     PYVIRNFNETSQQLSQCQNTANLNCSELLFPCIRCLYNYTCNYGQELYVNCSALHQVE
                     CQGSRWFWHQMNCRYCYQTEKWQQKCDQKGNCNSVNGQFYKTNCTVRSDVFCLGNRSF
                     TRNIKCNWTQGYRWSTAVIISLTLGGFGADRFYLGHWQEGIGKLFSFGGLGVWTIIDV
                     VLISLHYLGPADGSLYI"
     misc_feature    582..731
                     /gene="LOC106088036"
                     /note="TM2 domain; Region: TM2; pfam05154"
                     /db_xref="CDD:428337"
     polyA_site      886
                     /gene="LOC106088036"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaatgtcaag ttgtcatagt gtcgaacaaa aagaagatac aacaacctca ataacaaaaa
       61 taaattaaaa taaaatgtca cactgcatag taatagatcg tcgcaatgcc attatgctga
      121 tatggatatt tgtcctgagt ggcatacgac aaagttacac agaagaaaaa gcaagtggtg
      181 ttgcacccag taataacgag gtagctccct atgtaatccg caatttcaac gaaacctcac
      241 agcaattgtc gcaatgccaa aatacagcca acttgaattg cagtgaactc ctatttccgt
      301 gtataaggtg tttgtacaac tatacctgca attatggtca ggagttgtat gttaactgct
      361 cagccctgca tcaggtggag tgccagggta gtcgctggtt ttggcatcaa atgaattgtc
      421 gctattgcta tcaaacagag aagtggcaac aaaaatgcga ccagaaaggc aactgcaatt
      481 ctgtaaacgg ccaattttat aaaacaaatt gtacagtgcg atccgatgtt ttctgcctag
      541 gtaaccggtc gtttacaaga aatataaaat gcaattggac acagggctac cgatggagta
      601 cggcggtaat aataagcctg acattggggg gctttggagc agatcgattt tatttgggcc
      661 attggcagga aggcattggt aaactgttca gttttggagg tctaggcgta tggacgataa
      721 tagatgtggt gttaatatca cttcactatc tgggaccggc agatgggtca ttatatatat
      781 aactcgtgat agtaaataat acatcggtta gtttctaaga taatatacat atgtatcgtt
      841 aatgttaaaa tagaaaaaca tttactgatt gactttttta aaacca