Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013253322 886 bp mRNA linear INV 02-SEP-2023 almondex (LOC106088036), mRNA. ACCESSION XM_013253322 VERSION XM_013253322.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013253322.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..886 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..886 /gene="LOC106088036" /note="TM2 domain-containing protein almondex; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106088036" CDS 75..782 /gene="LOC106088036" /codon_start=1 /product="TM2 domain-containing protein almondex" /protein_id="XP_013108776.1" /db_xref="GeneID:106088036" /translation="MSHCIVIDRRNAIMLIWIFVLSGIRQSYTEEKASGVAPSNNEVA PYVIRNFNETSQQLSQCQNTANLNCSELLFPCIRCLYNYTCNYGQELYVNCSALHQVE CQGSRWFWHQMNCRYCYQTEKWQQKCDQKGNCNSVNGQFYKTNCTVRSDVFCLGNRSF TRNIKCNWTQGYRWSTAVIISLTLGGFGADRFYLGHWQEGIGKLFSFGGLGVWTIIDV VLISLHYLGPADGSLYI" misc_feature 582..731 /gene="LOC106088036" /note="TM2 domain; Region: TM2; pfam05154" /db_xref="CDD:428337" polyA_site 886 /gene="LOC106088036" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aaatgtcaag ttgtcatagt gtcgaacaaa aagaagatac aacaacctca ataacaaaaa 61 taaattaaaa taaaatgtca cactgcatag taatagatcg tcgcaatgcc attatgctga 121 tatggatatt tgtcctgagt ggcatacgac aaagttacac agaagaaaaa gcaagtggtg 181 ttgcacccag taataacgag gtagctccct atgtaatccg caatttcaac gaaacctcac 241 agcaattgtc gcaatgccaa aatacagcca acttgaattg cagtgaactc ctatttccgt 301 gtataaggtg tttgtacaac tatacctgca attatggtca ggagttgtat gttaactgct 361 cagccctgca tcaggtggag tgccagggta gtcgctggtt ttggcatcaa atgaattgtc 421 gctattgcta tcaaacagag aagtggcaac aaaaatgcga ccagaaaggc aactgcaatt 481 ctgtaaacgg ccaattttat aaaacaaatt gtacagtgcg atccgatgtt ttctgcctag 541 gtaaccggtc gtttacaaga aatataaaat gcaattggac acagggctac cgatggagta 601 cggcggtaat aataagcctg acattggggg gctttggagc agatcgattt tatttgggcc 661 attggcagga aggcattggt aaactgttca gttttggagg tctaggcgta tggacgataa 721 tagatgtggt gttaatatca cttcactatc tgggaccggc agatgggtca ttatatatat 781 aactcgtgat agtaaataat acatcggtta gtttctaaga taatatacat atgtatcgtt 841 aatgttaaaa tagaaaaaca tttactgatt gactttttta aaacca