PREDICTED: Stomoxys calcitrans migration and invasion enhancer 1

LOCUS       XM_013253318             565 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106088033), mRNA.
ACCESSION   XM_013253318
VERSION     XM_013253318.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253318.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..565
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..565
                     /gene="LOC106088033"
                     /note="migration and invasion enhancer 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 7 Proteins"
                     /db_xref="GeneID:106088033"
     CDS             194..481
                     /gene="LOC106088033"
                     /codon_start=1
                     /product="migration and invasion enhancer 1"
                     /protein_id="XP_013108772.1"
                     /db_xref="GeneID:106088033"
                     /translation="MVKVDVEYCGKCNFEWQCKMLQNFLQEQKPGTDIVCHKGRQGSF
                     EVKINDELVHSKLKSLAFPDHQSVLENVKRAELGQPMEKTKEQPIDNCIIM"
     misc_feature    203..415
                     /gene="LOC106088033"
                     /note="selT/selW/selH selenoprotein domain; Region:
                     CXXU_selWTH; TIGR02174"
                     /db_xref="CDD:274013"
     polyA_site      565
                     /gene="LOC106088033"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 acggatttaa aaagcagtgt aacggggttt cagctgttcg catgacctcc ccttataagt
       61 gcatcctgat gactaacctc ttaattgtac catgattttg tgtcaaaaca gatgttgaaa
      121 attctctgaa attaaactga aactgattca cttctattaa tgttcaatac ttctcttttc
      181 cgttactttc attatggtca aagttgatgt ggaatattgt ggtaaatgta atttcgaatg
      241 gcaatgcaaa atgttacaga actttctcca agaacagaag ccgggcactg acatcgtatg
      301 ccataaagga cgacaaggat ctttcgaagt gaaaattaac gacgaattag tgcactcgaa
      361 actgaaatca ttggcctttc ccgatcacca aagtgtttta gaaaacgtga agcgggcgga
      421 gctaggtcaa cccatggaga aaacaaaaga gcaacccatt gataattgta taattatgtg
      481 atgataatgg gtcggtggcg atagcgatgt acaaatatac gcacatggaa atagtaaata
      541 aaaagcctta tacgtagtta aacta