Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans actin-related protein 10


LOCUS       XM_013253130            1313 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087915), mRNA.
ACCESSION   XM_013253130
VERSION     XM_013253130.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253130.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1313
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..1313
                     /gene="LOC106087915"
                     /note="actin-related protein 10; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:106087915"
     CDS             100..1224
                     /gene="LOC106087915"
                     /codon_start=1
                     /product="actin-related protein 10"
                     /protein_id="XP_013108584.1"
                     /db_xref="GeneID:106087915"
                     /translation="MPLYETAMQEKPPVVLDIGTAYTKFGFAAEAYPRKILPTEVILS
                     SNGKTKNLFDYEDKLEFYDQMVDFLQTIFFKYLLVSPKERKIVVVENVFGQTIIRETL
                     AKALFRHFEVSSVLYVPSHMIALSTLAVPHGVVIDMGYNETTVMPVFSGVQIMQAFQD
                     QKFGGRALHEELKKMLVAAGVREDLLSETVLEDIKVRTCFVTNLKRAQAYSENQPPKA
                     PPFVEYPIGDEEIINIPGNVRETAFEIFFEENNDRDSLPHLILKSILSCPLDLRRTLT
                     ENIFVIGGSSIIMGMLPRLKEELQHLVTTDNEYKEKLHGDVKFKFHKSIGRPNITGWL
                     GGSLCGGTDLVNTRSLTKETYIRLERVPDWVCLDDNRVAG"
     misc_feature    139..1200
                     /gene="LOC106087915"
                     /note="nucleotide-binding domain (NBD) of actin-related
                     protein 10 (Arp10) and similar proteins; Region:
                     ASKHA_NBD_Arp10; cd10207"
                     /db_xref="CDD:466813"
     polyA_site      1313
                     /gene="LOC106087915"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacaaaatgt ttgttttctt tgcaagtttg ctatcacaac aaataacttt tttaggataa
       61 taatttctga ttttaaataa aggcttctaa cataacaata tgccattgta tgaaaccgca
      121 atgcaagaaa aaccaccagt ggttctagat atcggtacgg cttatactaa gtttggtttt
      181 gcggctgaag catatccaag aaaaattttg cccacagagg ttatattgtc ctcaaatggt
      241 aaaacaaaaa atcttttcga ttatgaagac aaattggaat tctatgatca aatggtcgac
      301 tttttgcaga caattttctt taaatactta cttgtgagtc caaaggaacg caaaattgtt
      361 gtggtcgaaa acgtttttgg acaaaccatt atacgagaaa cgttggccaa ggctttgttt
      421 cgccactttg aagtttcttc cgtgttgtat gtaccatccc atatgattgc cttgtcaaca
      481 ttagctgttc ctcacggcgt tgtaatagat atgggttata atgaaactac cgttatgcct
      541 gtctttagtg gcgttcaaat tatgcaagca ttccaagacc aaaagttcgg tgggcgcgct
      601 ttgcacgaag aactcaagaa gatgttagta gctgctggtg ttagggaaga cttgctgtcc
      661 gaaactgttt tagaggatat taaagtacgc acttgttttg taaccaatct aaaacgagcc
      721 caagcttatt cggaaaatca accgcccaaa gcacctccat tcgttgaata tcccatagga
      781 gatgaagaga tcatcaacat accgggcaac gtgcgagaaa ctgcatttga gattttcttt
      841 gaagaaaaca atgatcgcga tagtttgcca catttaatat tgaaatcgat attgagctgt
      901 ccgttggatc tacgacgcac attgaccgaa aatattttcg taattggtgg tagctctatt
      961 ataatgggta tgttgccacg actaaaagaa gagctacaac acttggttac aacggacaat
     1021 gaatacaaag aaaagctaca tggggatgtt aaatttaaat tccacaaaag cataggccgg
     1081 cctaatatta ccggttggtt gggtggatca ctttgcggag gaactgactt ggtaaatact
     1141 cgttcgttga caaaggaaac ctatatacgc ttggaaaggg tacccgattg ggtttgcctt
     1201 gatgataatc gtgtggctgg ataatgtgct tgtaattgtc gaaaaaatta atttcgtatt
     1261 tattataata attaccgaag taatataaac gcaaacttta aacctttaag aaa