Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013253120 470 bp mRNA linear INV 02-SEP-2023 ribonucleoprotein G (LOC106087912), transcript variant X2, mRNA. ACCESSION XM_013253120 VERSION XM_013253120.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013253120.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..470 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..470 /gene="LOC106087912" /note="probable small nuclear ribonucleoprotein G; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins" /db_xref="GeneID:106087912" CDS 128..358 /gene="LOC106087912" /codon_start=1 /product="probable small nuclear ribonucleoprotein G" /protein_id="XP_013108574.1" /db_xref="GeneID:106087912" /translation="MSKAHPPELKKYMDKRMLLKLNGGRSVAGILRGFDPFMNVVLDE TVEECKDSTRNNIGMVVIRGNSIVMVEALDRV" misc_feature 140..349 /gene="LOC106087912" /note="Sm protein G; Region: Sm_G; cd01719" /db_xref="CDD:212466" misc_feature order(149..151,161..163,185..187,200..202,239..241, 302..304,308..313,317..319,326..340,344..346) /gene="LOC106087912" /note="heptamer interface [polypeptide binding]; other site" /db_xref="CDD:212466" misc_feature order(176..196,200..238,242..256) /gene="LOC106087912" /note="Sm1 motif; other site" /db_xref="CDD:212466" misc_feature order(236..238,242..244,314..316,320..322) /gene="LOC106087912" /note="RNA binding site [nucleotide binding]; other site" /db_xref="CDD:212466" misc_feature 302..337 /gene="LOC106087912" /note="Sm2 motif; other site" /db_xref="CDD:212466" polyA_site 470 /gene="LOC106087912" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ccgtactcat ttttgcattc acagcacgct agccatctct aaaaaacgcc attagttttt 61 gtaatattgg taagctttgc ttggctacag ttcttttaat ttccaaaaat atttgccaga 121 acataaaatg tctaaagccc atccaccaga gttgaaaaag tacatggaca agcgtatgct 181 cctgaaactg aatggaggac gctctgtagc cggtattttg cggggatttg atcctttcat 241 gaacgttgta ctagacgaaa cagtcgaaga atgtaaagat agcacacgaa ataatattgg 301 aatggtggta attcgtggga atagcattgt aatggtggag gcactggaca gggtctaaag 361 ctctggagag aatcaatacc cagcagttca attagcataa gttatccatt gtatggtacg 421 tgtataataa aataaaaatc aataaaccga agataacttt aatgtcttta