Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans probable small nuclear


LOCUS       XM_013253120             470 bp    mRNA    linear   INV 02-SEP-2023
            ribonucleoprotein G (LOC106087912), transcript variant X2, mRNA.
ACCESSION   XM_013253120
VERSION     XM_013253120.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253120.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..470
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..470
                     /gene="LOC106087912"
                     /note="probable small nuclear ribonucleoprotein G; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 10 Proteins"
                     /db_xref="GeneID:106087912"
     CDS             128..358
                     /gene="LOC106087912"
                     /codon_start=1
                     /product="probable small nuclear ribonucleoprotein G"
                     /protein_id="XP_013108574.1"
                     /db_xref="GeneID:106087912"
                     /translation="MSKAHPPELKKYMDKRMLLKLNGGRSVAGILRGFDPFMNVVLDE
                     TVEECKDSTRNNIGMVVIRGNSIVMVEALDRV"
     misc_feature    140..349
                     /gene="LOC106087912"
                     /note="Sm protein G; Region: Sm_G; cd01719"
                     /db_xref="CDD:212466"
     misc_feature    order(149..151,161..163,185..187,200..202,239..241,
                     302..304,308..313,317..319,326..340,344..346)
                     /gene="LOC106087912"
                     /note="heptamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212466"
     misc_feature    order(176..196,200..238,242..256)
                     /gene="LOC106087912"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212466"
     misc_feature    order(236..238,242..244,314..316,320..322)
                     /gene="LOC106087912"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:212466"
     misc_feature    302..337
                     /gene="LOC106087912"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212466"
     polyA_site      470
                     /gene="LOC106087912"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ccgtactcat ttttgcattc acagcacgct agccatctct aaaaaacgcc attagttttt
       61 gtaatattgg taagctttgc ttggctacag ttcttttaat ttccaaaaat atttgccaga
      121 acataaaatg tctaaagccc atccaccaga gttgaaaaag tacatggaca agcgtatgct
      181 cctgaaactg aatggaggac gctctgtagc cggtattttg cggggatttg atcctttcat
      241 gaacgttgta ctagacgaaa cagtcgaaga atgtaaagat agcacacgaa ataatattgg
      301 aatggtggta attcgtggga atagcattgt aatggtggag gcactggaca gggtctaaag
      361 ctctggagag aatcaatacc cagcagttca attagcataa gttatccatt gtatggtacg
      421 tgtataataa aataaaaatc aataaaccga agataacttt aatgtcttta