Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans small ribosomal subunit protein


LOCUS       XM_013253119             566 bp    mRNA    linear   INV 02-SEP-2023
            eS19A (LOC106087911), mRNA.
ACCESSION   XM_013253119
VERSION     XM_013253119.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253119.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..566
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..566
                     /gene="LOC106087911"
                     /note="small ribosomal subunit protein eS19A; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 EST, 25 Proteins"
                     /db_xref="GeneID:106087911"
     CDS             38..508
                     /gene="LOC106087911"
                     /codon_start=1
                     /product="small ribosomal subunit protein eS19A"
                     /protein_id="XP_013108573.1"
                     /db_xref="GeneID:106087911"
                     /translation="MPGVTVKDIDQHACVKAVASFLKKTGKLKVPDQMDIIKTAKYKE
                     LAPYDPDWFYIRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARK
                     ALQSLEHARLIEKHPDGGRKLTPIGQRDLDRIANQIVSKQREATKVAGPIVISE"
     misc_feature    50..460
                     /gene="LOC106087911"
                     /note="Ribosomal protein S19e; Region: Ribosomal_S19e;
                     pfam01090"
                     /db_xref="CDD:460058"
     polyA_site      566
                     /gene="LOC106087911"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aacatgtcct ttcttccggt tctctctgtc aagcaagatg cccggcgtta cagtaaaaga
       61 tattgatcaa cacgcttgcg tcaaggctgt tgccagtttc ttgaaaaaga ctggtaaatt
      121 gaaggtaccc gaccaaatgg acattattaa aaccgctaaa tataaggaat tggctcccta
      181 tgaccccgat tggttctaca tccgttgtgc ttcgattttg cgtcatttgt accaccgcag
      241 tcccgctggt gttggttcaa tcaccaaaat ctatggtgga cgtaaacgca acggtgttca
      301 cccatcccac ttctgccgcg ctgctgacgg tgctgctcgc aaagctttgc aatcattgga
      361 acatgcccgc cttattgaaa agcaccccga tggtggtcgc aaattgactc caattggcca
      421 acgtgatttg gatcgtattg caaaccaaat cgtttccaaa caacgtgaag ccactaaagt
      481 agctggtcct attgtcatct ctgaataaaa tatgttgaca attatttgtt gacggtaata
      541 aaaagatcca tactttttta aattaa