Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013253119 566 bp mRNA linear INV 02-SEP-2023 eS19A (LOC106087911), mRNA. ACCESSION XM_013253119 VERSION XM_013253119.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013253119.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..566 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..566 /gene="LOC106087911" /note="small ribosomal subunit protein eS19A; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 25 Proteins" /db_xref="GeneID:106087911" CDS 38..508 /gene="LOC106087911" /codon_start=1 /product="small ribosomal subunit protein eS19A" /protein_id="XP_013108573.1" /db_xref="GeneID:106087911" /translation="MPGVTVKDIDQHACVKAVASFLKKTGKLKVPDQMDIIKTAKYKE LAPYDPDWFYIRCASILRHLYHRSPAGVGSITKIYGGRKRNGVHPSHFCRAADGAARK ALQSLEHARLIEKHPDGGRKLTPIGQRDLDRIANQIVSKQREATKVAGPIVISE" misc_feature 50..460 /gene="LOC106087911" /note="Ribosomal protein S19e; Region: Ribosomal_S19e; pfam01090" /db_xref="CDD:460058" polyA_site 566 /gene="LOC106087911" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 aacatgtcct ttcttccggt tctctctgtc aagcaagatg cccggcgtta cagtaaaaga 61 tattgatcaa cacgcttgcg tcaaggctgt tgccagtttc ttgaaaaaga ctggtaaatt 121 gaaggtaccc gaccaaatgg acattattaa aaccgctaaa tataaggaat tggctcccta 181 tgaccccgat tggttctaca tccgttgtgc ttcgattttg cgtcatttgt accaccgcag 241 tcccgctggt gttggttcaa tcaccaaaat ctatggtgga cgtaaacgca acggtgttca 301 cccatcccac ttctgccgcg ctgctgacgg tgctgctcgc aaagctttgc aatcattgga 361 acatgcccgc cttattgaaa agcaccccga tggtggtcgc aaattgactc caattggcca 421 acgtgatttg gatcgtattg caaaccaaat cgtttccaaa caacgtgaag ccactaaagt 481 agctggtcct attgtcatct ctgaataaaa tatgttgaca attatttgtt gacggtaata 541 aaaagatcca tactttttta aattaa