Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_013253115 426 bp mRNA linear INV 02-SEP-2023 (LOC106087908), mRNA. ACCESSION XM_013253115 VERSION XM_013253115.2 DBLINK BioProject: PRJNA1009844 KEYWORDS RefSeq. SOURCE Stomoxys calcitrans (stable fly) ORGANISM Stomoxys calcitrans Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Muscoidea; Muscidae; Stomoxys. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_081555) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Sep 2, 2023 this sequence version replaced XM_013253115.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_963082655.1-RS_2023_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.1 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/29/2023 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..426 /organism="Stomoxys calcitrans" /mol_type="mRNA" /db_xref="taxon:35570" /chromosome="4" gene 1..426 /gene="LOC106087908" /note="PI-stichotoxin-Hcr2n-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:106087908" CDS 56..310 /gene="LOC106087908" /codon_start=1 /product="PI-stichotoxin-Hcr2n-like" /protein_id="XP_013108569.1" /db_xref="GeneID:106087908" /translation="MKVIALLVVFIVAIFSVTTAASSVCTLAHSQIGHCRARVPAWSF DKRTKACVPFTYGGCGGNKNRFNSQAACERQCMNGPKGPQ" misc_feature 149..283 /gene="LOC106087908" /note="Kunitz/Bovine pancreatic trypsin inhibitor (BPTI) domain; Region: Kunitz-type; cd00109" /db_xref="CDD:438633" misc_feature order(149..163,167..175,218..220,230..232) /gene="LOC106087908" /note="putative serine protease binding site [polypeptide binding]; other site" /db_xref="CDD:438633" polyA_site 426 /gene="LOC106087908" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tttactatgc acttcatttc catattggat cttaaaccat tcgcatcata gcaaaatgaa 61 agtaatcgct ttgttggttg tatttatcgt ggcaattttc tctgtgacaa ctgcagcatc 121 ctcggtatgt acactagcac actcccaaat tggtcattgt cgtgctcgcg tcccggcctg 181 gtcttttgat aaacgaacca aagcttgtgt gcccttcact tacggtggtt gtggcggcaa 241 caagaaccgt ttcaattctc aggctgcctg cgaacgacaa tgtatgaatg gacccaaggg 301 accgcaataa gaccgaaaaa ttgccttaca atgggcaaag tcaaaaatga tgtaaatgac 361 actaataatt atattaaaat ttttgaattt taataaaagt cgcggttaat ttgcctggta 421 aaattt