Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Stomoxys calcitrans PI-stichotoxin-Hcr2n-like


LOCUS       XM_013253115             426 bp    mRNA    linear   INV 02-SEP-2023
            (LOC106087908), mRNA.
ACCESSION   XM_013253115
VERSION     XM_013253115.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253115.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..426
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..426
                     /gene="LOC106087908"
                     /note="PI-stichotoxin-Hcr2n-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:106087908"
     CDS             56..310
                     /gene="LOC106087908"
                     /codon_start=1
                     /product="PI-stichotoxin-Hcr2n-like"
                     /protein_id="XP_013108569.1"
                     /db_xref="GeneID:106087908"
                     /translation="MKVIALLVVFIVAIFSVTTAASSVCTLAHSQIGHCRARVPAWSF
                     DKRTKACVPFTYGGCGGNKNRFNSQAACERQCMNGPKGPQ"
     misc_feature    149..283
                     /gene="LOC106087908"
                     /note="Kunitz/Bovine pancreatic trypsin inhibitor (BPTI)
                     domain; Region: Kunitz-type; cd00109"
                     /db_xref="CDD:438633"
     misc_feature    order(149..163,167..175,218..220,230..232)
                     /gene="LOC106087908"
                     /note="putative serine protease binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:438633"
     polyA_site      426
                     /gene="LOC106087908"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tttactatgc acttcatttc catattggat cttaaaccat tcgcatcata gcaaaatgaa
       61 agtaatcgct ttgttggttg tatttatcgt ggcaattttc tctgtgacaa ctgcagcatc
      121 ctcggtatgt acactagcac actcccaaat tggtcattgt cgtgctcgcg tcccggcctg
      181 gtcttttgat aaacgaacca aagcttgtgt gcccttcact tacggtggtt gtggcggcaa
      241 caagaaccgt ttcaattctc aggctgcctg cgaacgacaa tgtatgaatg gacccaaggg
      301 accgcaataa gaccgaaaaa ttgccttaca atgggcaaag tcaaaaatga tgtaaatgac
      361 actaataatt atattaaaat ttttgaattt taataaaagt cgcggttaat ttgcctggta
      421 aaattt