PREDICTED: Stomoxys calcitrans uncharacterized histidine-rich

LOCUS       XM_013253047             603 bp    mRNA    linear   INV 02-SEP-2023
            protein DDB_G0274557 (LOC106087856), mRNA.
ACCESSION   XM_013253047
VERSION     XM_013253047.2
DBLINK      BioProject: PRJNA1009844
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Stomoxys calcitrans (stable fly)
  ORGANISM  Stomoxys calcitrans
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Muscoidea; Muscidae; Stomoxys.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_081555) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Sep 2, 2023 this sequence version replaced XM_013253047.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_963082655.1-RS_2023_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/29/2023
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 17% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..603
                     /organism="Stomoxys calcitrans"
                     /mol_type="mRNA"
                     /db_xref="taxon:35570"
                     /chromosome="4"
     gene            1..603
                     /gene="LOC106087856"
                     /note="uncharacterized histidine-rich protein
                     DDB_G0274557; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 7 Proteins"
                     /db_xref="GeneID:106087856"
     CDS             157..603
                     /gene="LOC106087856"
                     /codon_start=1
                     /product="uncharacterized histidine-rich protein
                     DDB_G0274557"
                     /protein_id="XP_013108501.1"
                     /db_xref="GeneID:106087856"
                     /translation="MKFLIVCSLLVASAASLKIHEYAEYKHEGGEHEAHHGGEEIEAH
                     HEVEHKHATSHQSVKFHHYHPVPVYIKKEDQHLVKKPVEIGGTKQKLKILHPETKKNH
                     NHGLVLEEHSESKFHHIGHHEEEPEHHHHEEEHSAHYEHYYPHHHE"
ORIGIN      
        1 tcgcgtgcct aggaagcgag ttcagtgtat ttaacataaa agaaagttta attcaaatca
       61 aattcgaaaa aaacttgttg tgtaagagaa agaaggaaat taccaagaag caacaaacca
      121 agagaaaaaa caaccccaaa acaagaaatt ataaaaatga agtttctgat tgtttgctcc
      181 ttgctggtgg cctccgctgc ttccttgaaa atccatgaat atgccgaata taagcatgag
      241 ggtggcgaac atgaggccca ccatggaggc gaggagatcg aagcccatca tgaagttgag
      301 cataaacacg ccacctccca tcagagtgta aaattccatc attatcatcc cgtgccggtg
      361 tacatcaaaa aggaagacca gcatttggtt aagaagcccg tggagattgg aggcaccaaa
      421 caaaaattga agatcctcca tcctgagact aagaagaatc ataatcatgg tttggttttg
      481 gaagagcata gcgaatcgaa attccatcac atcggccatc atgaggagga gcccgagcat
      541 catcatcacg aagaggagca ttcggcccac tatgaacact actatcctca tcaccatgaa
      601 tag